KEGG   Rattus norvegicus (rat): 683519Help
Entry
683519            CDS       T01003                                 

Gene name
Mrps22
Definition
(RefSeq) mitochondrial ribosomal protein S22
  KO
K17401  small subunit ribosomal protein S22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    683519 (Mrps22)
   03029 Mitochondrial biogenesis [BR:rno03029]
    683519 (Mrps22)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    683519 (Mrps22)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    683519 (Mrps22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP-S22
Motif
Other DBs
NCBI-GeneID: 683519
NCBI-ProteinID: NP_001070998
RGD: 1585674
Ensembl: ENSRNOG00000047984
UniProt: Q0D2L2
Position
8q31
AA seq 359 aa AA seqDB search
MAAVRSPLSLWRFQLSTRRARRVCTRVAAQRHSNALLATWSQPFEVGQPRRPFSSEAESG
SSEVKKPTFMDEEVQSILTKMTGLDLQKTFKPAVQPLKPPTYKLMTQAQLEEATRLAVEA
AKIRLKMPPVLEERKPINDVLAEDKILEGTETNKYVFTDISYNIPHRERFIVVREPSGTL
RKASWEERDRVIQIYFPKEGRRVLPPVIFKDENLKTMYSQDRHADVLNLCVAQFEPDSTE
YIKVHHQTYEDIDRHGKYEILRSTRHFGGMAWYLVNNKKIDGLLIDQIQRDLVDDATSLV
QLYHMLHPEGQSAQEAKEQAAEGVNLIKVFAKTEAQRGAYIELALQTYQEIVISHSATS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtcagatctccgttgtctctgtggaggttccagttgagcactcggcgagca
cggcgggtctgtactcgggtcgcagcccagcgccactccaatgctctgctcgcgacgtgg
tcccagccctttgaagtggggcagcctcgccgccctttcagctccgaggcagaatctggt
agctcagaagtcaagaaacctacttttatggatgaggaggtccagagcatcctcaccaag
atgacaggcctggacttgcagaagactttcaagcctgctgtacaaccactgaagccacca
acctacaagttaatgacccaggcacagctggaggaggctacgagactggcagttgaggca
gctaaaatacgattaaagatgccaccagttctggaagaacgaaagccaataaatgatgtg
ttagccgaggataagatcttggaaggaacagaaacaaacaaatatgtgtttactgacata
tcgtataacataccacaccgggaacgttttattgttgttagagaaccaagtggcacacta
cgcaaagcttcatgggaagaacgggacagggtgatacaaatttatttcccgaaagaaggt
cgtagagttttgccaccagtaattttcaaagatgagaaccttaagaccatgtacagccaa
gaccggcatgctgatgtcctcaatctctgtgttgcccagtttgagccagattccactgag
tatatcaaggttcatcaccagacctacgaagatatagacagacatggaaaatatgagatt
ttacgttcaacaagacactttggtggaatggcttggtatttggtaaataacaaaaagatc
gatggtttgctcatcgatcagatccagagagacttggttgatgatgccaccagcctggtc
cagctgtaccacatgctccatccagaaggccagtcagcccaagaggccaaagagcaggct
gctgagggagtcaacttaattaaggtctttgcaaaaacagaagcacagagaggagcatat
atagaattagcacttcaaacttatcaagaaatagtcatcagccattctgcaacatcctga

DBGET integrated database retrieval system