KEGG   Rattus norvegicus (rat): 683570
Entry
683570            CDS       T01003                                 

Gene name
Gnpda1
Definition
(RefSeq) glucosamine-6-phosphate deaminase 1
  KO
K02564  glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    683570 (Gnpda1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     683570 (Gnpda1)
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-GeneID: 683570
NCBI-ProteinID: NP_001128467
RGD: 1585624
Ensembl: ENSRNOG00000047213
UniProt: B5DFC6
Position
18p11
AA seq 289 aa
MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTPLGCYQKLIEYYKNGD
LSFKYVKTFNMDEYVGLPREHPESYHSFMWNNFFKHIDIHPENTHILDGNAADLQAECDS
FEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGDLAK
VPTMALTVGVGTVMDAKEVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCD
EDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKEIQKSQSAKKPYSD
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaagctcattattctggaacactattcacaggccagtgagtgggcggccaagtatatt
aggaaccgcatcatccagtttaacccaggacctgacaagtacttcaccctggggctcccc
accgggagcaccccgcttggctgctaccagaagctgattgagtactataagaatggggac
ctgtcctttaaatatgtgaaaaccttcaacatggacgagtatgtgggtcttcctcgagag
cacccagagagctaccactccttcatgtggaataacttcttcaagcacattgacatccac
cctgaaaacacccacattttggatggaaacgcggctgacctgcaggctgagtgcgactcc
tttgaggagaagatccaggctgcaggagggatcgagctctttgttggaggcattggcccc
gatggacacattgccttcaatgagccaggctccagtctggtgtccaggacccgtgtgaag
actctggccatggacaccatcctggccaacgctagattctttgatggtgatcttgccaag
gtgcccaccatggccctgacagtgggtgtgggcactgtcatggatgctaaagaggtgatg
atcctcatcacaggtgctcacaaggctttcgctctgtacaaagccattgaagagggtgtg
aaccacatgtggacggtgtctgcctttcagcagcatcctcgcactgtgtttgtgtgtgac
gaggatgccaccttggaactaaaagtgaagaccgtcaagtatttcaaaggtttaatgctt
gttcataacaagttggtggaccccctgtacagtatcaaggagaaggaaattcagaaaagc
caatctgctaagaagccatacagtgactag

DBGET integrated database retrieval system