KEGG   Rattus norvegicus (rat): 683758
Entry
683758            CDS       T01003                                 

Gene name
Klrb1c, Klrb1f, NKR-P1F
Definition
(RefSeq) killer cell lectin-like receptor subfamily B member 1C
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    683758 (Klrb1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    683758 (Klrb1c)
   04091 Lectins [BR:rno04091]
    683758 (Klrb1c)
CD molecules [BR:rno04090]
 Proteins
  683758 (Klrb1c)
Lectins [BR:rno04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   683758 (Klrb1c)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 683758
NCBI-ProteinID: NP_001078872
RGD: 1583336
Ensembl: ENSRNOG00000007811
UniProt: Q63378
Position
4q42
AA seq 217 aa
MDTSRVYGNVKTFRSPGHKQASFPSLSTDACRCPHWHHLALKLGCATLILLLLTLIGLSV
FVRFLVQKPLIEKCSMAAQENGTEPTGRSAILECPRHWQPHRNKCLIISQISRPWAEGLV
ACSMKEATLLIIENEEELKFVQNILKGRQQLFFIGLNYVQTEMTWKWINGSVLKPNILRI
TGSEVENSCALISHTEVFSDSCSSDNHWICQKTLKHV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggacacatcaagagtctatggtaatgtaaagacatttaggtctccagggcataagcaa
gcatcattcccatctctctccacagatgcttgtcggtgcccacactggcatcatttggct
ctgaaacttggctgtgctacgctgatccttcttctcttgaccctgattggactcagtgtc
ttcgtgagattcctagtgcaaaaaccactaatagaaaaatgcagtatggctgctcaagag
aatgggactgaaccaacagggagatcagccatactagaatgcccgagacattggcaacca
caccggaacaaatgcttaattatttctcaaatttccagaccttgggcagaaggtctagtt
gcctgttctatgaaagaagccactttgttgatcattgaaaatgaagaagaactgaagttt
gtgcagaacattttaaagggaagacagcagttattttttattggactaaattatgtacaa
acggagatgacctggaagtggataaatggctctgttttaaagcctaacatattacggatc
actggttcggaggtagagaacagctgtgccctcatctcacacacagaagtgttttcagat
tcctgttcttcagacaaccattggatctgccaaaagaccctgaaacatgtctga

DBGET integrated database retrieval system