KEGG   Rattus norvegicus (rat): 683788
Entry
683788            CDS       T01003                                 

Gene name
Fscn1, Fascin
Definition
(RefSeq) fascin actin-bundling protein 1
  KO
K23551  fascin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    683788 (Fscn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    683788 (Fscn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    683788 (Fscn1)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    683788 (Fscn1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     683788 (Fscn1)
SSDB
Motif
Pfam: Fascin FRG1 DUF569
Other DBs
NCBI-GeneID: 683788
NCBI-ProteinID: NP_001094276
RGD: 1583309
UniProt: P85845
Position
12p11
AA seq 493 aa
MTANGTAEAVQIQFGLISCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAV
CLRSHLGPYLAADKDGNVTCEREVPDGDCRFLVVAHDDGRWSLQSEAHRRYFGGTEDRLS
CFAQSVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLA
FQDQRYSVQTSDHRFLRHDGRLVARPEPATGFTLEFRSGKVAFRDCEGRYLAPSGPSGTL
KAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMDLSANQDEETDQETFQLEIDR
DTRKCAFRTHTGKYWTLTATGGVQSTASTKNASCYFDIEWCERRITLRASNGKFVTAKKN
GQLAATVETAGDSELFLMKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFND
GAYNIKDSTGKYWTVGSDSSVTSSSDTPVDFFLEFCDYNKVALKVGGRYLKGDHAGVLKA
CAETIDPATLWEY
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaccgccaacggcacggccgaggctgtgcagatccagttcgggctcatcagctgcggc
aacaagtacctgacagccgaggcgttcgggttcaaggtgaacgcatccgctagtagcttg
aagaagaagcagatctggacgctggagcaacctcccgatgaggcgggcagcgcggccgtg
tgtctgcgcagccacctgggtccctacctggccgccgacaaggacggcaatgtgacctgc
gagcgcgaggtacctgacggcgactgccgcttcctcgtcgtggcacacgacgacggccgc
tggtcgctgcagtccgaggcgcaccggcgctacttcggcggcaccgaggaccgcctgtcc
tgcttcgcgcagagcgtgtcgccggccgagaagtggagcgtgcacatcgccatgcacccg
caggtcaacatctacagcgtcacccgcaagcgctacgctcatctgagcgcgcgaccggcc
gacgagatcgcggtagaccgcgacgtgccttggggcgtcgactcgctcatcaccttggcc
ttccaggaccagcgctacagcgtgcagacgtcggaccaccgcttcctgcgccacgacggg
cgccttgtggcgcggcctgagcccgccacgggcttcacactggagttccgctccggcaag
gtggcctttcgcgactgcgaaggtcgctacctggctccgtccgggcccagcggcaccctc
aaggctggcaaggccaccaaggtgggcaaagatgagctcttcgccctggaacagagctgc
gctcaggtggtgctgcaggcagccaacgagaggaacgtgtccacgcgccagggaatggac
ctgtcagccaatcaggatgaagagacggatcaggagaccttccagctggagattgaccgg
gacacaagaaagtgtgccttccgcacccacacgggcaagtactggacgctgacagcgact
ggaggtgtgcagtccactgcatccactaagaatgccagctgctactttgacattgagtgg
tgtgagcggcggatcactctgagagcgtccaacggcaagtttgtgaccgccaagaaaaac
ggccaactggctgccactgtggagacagcaggggactcggaactcttcctcatgaagctg
attaaccgccccatcatcgtgttccgtggggagcacgggttcattggctgccgcaaggtc
acgggcaccctggacgccaatcgctccagttacgacgtctttcagctggagttcaatgat
ggcgcctacaacatcaaagactccacgggcaagtactggacggtgggtagcgactcctcg
gtcaccagcagcagcgacacccccgtggatttcttccttgagttctgtgactacaataag
gtggctctcaaggtgggcggtcgctacctgaagggggaccacgccggggtcctgaaggcc
tgcgcggagactatcgaccccgccacactctgggagtactag

DBGET integrated database retrieval system