KEGG   Rattus norvegicus (rat): 683849
Entry
683849            CDS       T01003                                 

Definition
(RefSeq) similar to Anionic trypsin II precursor (Pretrypsinogen II)
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04972  Pancreatic secretion
rno04974  Protein digestion and absorption
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    683849
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    683849
   04974 Protein digestion and absorption
    683849
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    683849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    683849
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    683849
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     683849
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   683849
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   683849
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 683849
NCBI-ProteinID: XP_001068290
RGD: 1597830
Ensembl: ENSRNOG00000050493
UniProt: W4VSR6
Position
4q23
AA seq 246 aa
MSALLILALVGTAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLN
ARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKIT
DNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIE
DTIAAN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgagtgctctcctgatccttgcccttgtggggactgctgttgctttccctgtggatgat
gatgacaagatcgttggaggatacacctgtcaggagaattctgtcccctaccaggtatcc
ctgaattctggctaccacttctgtggaggctccctgatcaatgaccaatgggtggtgtct
gcagctcactgctacaaatcccgcatccaagtgagactgggagagcacaacatcaatgtc
cttgagggcaatgagcagtttgtcaatgctgccaagatcatcaagcatcccaacttcgat
aggaagaccctaaacaatgacatcatgctgatcaagctctcttcccctgtgaaactcaat
gctcgagtggccactgtggctctgcccagctcctgtgcacctgcaggcactcagtgcctc
atctctggctggggcaacacccttagctttggtgtcaatgaaccagacctgctccagtgc
ctggatgccccactgctgcctcaggctgactgtgaagcctcctaccctggaaagatcact
gacaacatggtctgtgctggcttcctagagggaggcaaggattcctgccagggtgactct
ggtggccctgtagtctgcaatggagagctccagggtattgtctcctggggctatggctgt
gccctgccagataaccctggtgtgtacaccaaggtctgcaactatgtggactggattgag
gacacaatcgctgccaactag

DBGET integrated database retrieval system