KEGG   Rattus norvegicus (rat): 683927Help
Entry
683927            CDS       T01003                                 

Gene name
Cstf2
Definition
(RefSeq) cleavage stimulation factor subunit 2
  KO
K14407  cleavage stimulation factor subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    683927 (Cstf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    683927 (Cstf2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     683927 (Cstf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSTF2_hinge RRM_1 CSTF_C RRM_7 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 683927
NCBI-ProteinID: NP_001124486
RGD: 1596566
Ensembl: ENSRNOG00000048025
UniProt: B4F7F1
Position
Xq32
AA seq 575 aa AA seqDB search
MAGLPVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGESIS
PEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMR
IVDPEIALKILHRQTNIPTLISGNPQPVHVAGPGSGPNVSMNQQNPQAPQAQSLSGMHVN
GAPPMMQASMPGGVPAPVQMAAAVAGPGPGSLAPAGVMQAQVGMQGAGPVPMERGQVPMQ
DPRAAMQRGALPANVPTPRGLLGDAPNDPRGGTLMTVTGEVEPRAYLGPPPPPHQGPPMH
HVPGHEGRGPPPHDMRGGPLAEPRPLMAEPRGPMLDQRGPPLDARGGRDPRGLDARGMEA
RAMEARGLEARAMEARAMEARAMEARAMEARAMEARAMEARGMDTRGPVPGPRGPIPSGI
QGPNPMNMGAVVPQGSRQVPVMQGAGMQGASMQGGSQPGGFSPGQSQVTPQDHEKAALIM
QVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtttgcctgttagagaccctgcggtggatcgttctctgcgttctgtattcgtg
gggaacattccttatgaagctactgaagaacaactgaaggacatcttctctgaggttggg
cctgttgttagtttcagattggtatacgatagggagacaggaaaaccaaagggttatggc
ttctgcgaataccaagaccaagagacagcacttagtgccatgcggaacttgaatgggcgt
gaattcagtgggagagcacttcgagtggacaatgctgccagtgaaaagaacaaagaggaa
ctgaagagccttggcactggtgcacctgtcatagagtcaccttatggagaaagcatcagc
cctgaggatgcccctgaatccattagcaaagctgttgccagtcttccgccagaacagatg
tttgaactgatgaaacaaatgaagctctgtgtccagaatagtccccaggaagcacgaaac
atgttgcttcagaacccacagctggcttatgctttgctgcaagcacaggtagtgatgaga
attgtggatcctgagattgccctgaaaattctgcaccgccagacaaatatcccaacgctg
atttcaggcaaccctcagccagtccatgttgccggacctggctcaggacccaatgtttca
atgaaccagcagaatcctcaggcccctcaggctcaatctttgagtggaatgcatgtcaat
ggcgcacctcctatgatgcaagcttctatgccaggtggagttccagcaccagtgcagatg
gcagctgctgtagcaggacctggccctggttccttagcccctgcaggagtcatgcaagcc
caagttggaatgcaaggagctggaccagtgcccatggaacgaggacaagtgccaatgcaa
gaccccagagcagctatgcagcggggagccttgcctgccaacgtcccaactcctcgtggt
cttttaggtgatgctcccaatgatccacggggaggcactttaatgaccgtaactggagaa
gtagaacctagagcttacctgggaccaccaccaccacctcatcagggcccaccgatgcac
cacgttcctggccatgaaggtcgtggaccaccaccgcatgacatgagaggaggaccgtta
gctgagcccagaccgttaatggcagagccaagaggacctatgctagatcagaggggtcca
ccgttggatgccagaggtggaagagatccccgaggattagatgcacgagggatggaggcc
agagccatggaagccagaggactggaagcccgtgccatggaagcccgtgccatggaagcc
cgtgccatggaagctcgtgccatggaggcccgagccatggaggctcgtgccatggaggcc
agaggcatggataccagaggcccagtacctggacctagaggacctatacctagtggaatc
caaggccccaatccaatgaacatgggggcagttgttccccagggatccagacaggtccca
gtcatgcagggagcaggcatgcaaggagcaagcatgcaaggtggaagccagcctggtggc
tttagtcctggacagagccaagtcacaccccaggatcatgagaaggctgctttgattatg
caggtccttcaactcactgcagaccagattgccatgctgcctcctgagcaaagacagagc
atcctaatcttaaaggaacagatacagaaatccaccggggcaccttga

DBGET integrated database retrieval system