KEGG   Rattus norvegicus (rat): 684158Help
Entry
684158            CDS       T01003                                 

Gene name
Rd3
Definition
(RefSeq) retinal degeneration 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RD3
Motif
Other DBs
NCBI-GeneID: 684158
NCBI-ProteinID: XP_006221671
RGD: 1593897
Ensembl: ENSRNOG00000050766
UniProt: M0R688
Position
13q27
AA seq 195 aa AA seqDB search
MSLIPWLRWNDTPPRLSARSPAEMVLETLMMELAGQMREVERQQRERRSAVRKICTGVDY
SWLASAPRPTYDISPGERLQLEDVCAKIHPSYCGPAILRFRQLLAEREPEVQEVARLFRS
VLQEALEKMKQEEEAHKLTRQWSLRPRGSLSSFKTRARIAPFASDIRTISEDVERDAPPP
PRTWSMPEFRAPQAD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcatcccatggctccggtggaacgacacccctccccggctctcagcccggagc
ccggcagagatggtgctggagacactcatgatggagctggccgggcagatgagagaggtg
gagcggcaacagagggagcgtcgcagtgcggttaggaagatctgcacgggtgtggactac
agctggctggccagcgcgcccagacccacctatgacatcagccctggtgagcggctgcag
ctggaggatgtatgtgccaagatccacccatcctactgtgggcctgccatcctcaggttc
cgacagctgctggcggaacgagagcccgaggtgcaggaggtggcgcggctgttccgctct
gtgttgcaggaggccctggagaagatgaagcaggaggaggaggcccataagctgactcgt
cagtggagcttgaggccccgcggcagcctgtcgtcttttaagacccgcgctcgcatcgcg
cccttcgccagtgacatccggaccatctcggaggacgtggagcgcgacgcgccacccccg
ccgcgcacctggagcatgccggagttcagggcgccccaggccgactga

DBGET integrated database retrieval system