KEGG   Rattus norvegicus (rat): 684439Help
Entry
684439            CDS       T01003                                 

Gene name
Cenpo
Definition
(RefSeq) centromere protein O
  KO
K11507  centromere protein O
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    684439 (Cenpo)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     684439 (Cenpo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-O TSC22 DUF3408 Uso1_p115_C
Motif
Other DBs
NCBI-GeneID: 684439
NCBI-ProteinID: XP_001070398
RGD: 1590328
Ensembl: ENSRNOG00000050111
UniProt: M0R9I1
Position
6q14
AA seq 299 aa AA seqDB search
MESANSLCPGTECKGGVLAHLERLEAQMNRSNRKSEEPTVREKESSLRTKIRELQQQRDR
LRVEVKQWRARVKESSAKEDSSKTTLSEQEVLEKQWRNLKAILQAYRFTGLSGKLTNRRV
CVYISTAFEGNLLDSYFVDLAIEKPLRIHHHSIPAFIPLEKIATAYLQTDVQRLLFSLSE
YLNAYVGRKYQADQLESDFCAFLTGPLQRSALCNLLSFTYKVEHGTQAFSFSARLLYEDL
TAALPTGVTVTRPAGVEASSPHWEEHRASHEMLFRTKTLHQAFASFSKETEMLHLNLVS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgcaaattctttgtgtccaggcacagagtgtaaaggaggtgttttagctcac
ctggaaagactagaggctcaaatgaacagatcgaatagaaagtctgaagaaccaacagtt
cgtgaaaaggaaagttctcttagaaccaagattcgagaactgcagcaacagcgagatagg
ctgagggtggaagtgaagcagtggcgagccagagttaaagaatcttctgccaaagaagac
tcaagcaaaaccacgcttagtgaacaggaagttctggaaaagcagtggagaaacctgaaa
gccattctgcaggcatatcgatttacagggctcagcgggaagttgaccaaccgtagagtc
tgtgtgtacatcagcaccgcctttgaggggaacctactagattcctactttgtggacctc
gccatagagaaaccactccggattcatcaccattccatcccagccttcatccctctggaa
aagatagccacagcatacctacagactgacgttcagcgcctcctgtttagtctctcggag
tacctaaatgcctacgtgggaaggaagtatcaggcagaccaacttgagagtgacttctgc
gctttcctcacgggacctttgcagagaagcgccctgtgcaacttgctgtcattcacctat
aaagtggaacacgggacccaggccttctcctttagtgccaggttgctgtatgaggacctc
acagcagctcttcccacaggagtcactgtgacaaggccagcaggtgtggaagcatcgtcc
cctcattgggaagagcacagagcatcccatgaaatgctcttccgtaccaagaccctgcac
caggcgtttgcttcattttccaaagagacagaaatgctgcatttgaacctggtctcctga

DBGET integrated database retrieval system