KEGG   Rattus norvegicus (rat): 684516Help
Entry
684516            CDS       T01003                                 

Gene name
Kcnc4
Definition
(RefSeq) potassium voltage-gated channel subfamily C member 4
  KO
K04890  potassium voltage-gated channel Shaw-related subfamily C member 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    684516 (Kcnc4)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   684516 (Kcnc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Potassium_chann Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 684516
NCBI-ProteinID: NP_001116248
RGD: 1589169
Ensembl: ENSRNOG00000060988
UniProt: Q63734
Position
2q34
AA seq 625 aa AA seqDB search
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWLADPDGGGRPESDGGGAGSSGSSGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPA
DVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGD
DERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVS
ITTFCLETHEAFNIDRNVTEIHRVGNITSVRFRREVETEPILTYIEGVCVMWFTLEFLVR
IVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFK
LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTD
FKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY
SLAMAKQKLPKKRKKHVPRPPQLESPIYCKSEETSPRDSTYSDTSPPAREEGMVERKRAD
SKQNGDANAVLSDEEGAGLTQPLASAPTPEERRALRRSGTRDRNKKAAACFLLSAGDYAC
ADGSVQKEGSVEPKACVPVSHTCAL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgatcagctcggtgtgtgtctcctcctaccgcgggcgcaagtcggggaacaagcctccg
tccaaaacatgtctgaaggaggagatggccaagggcgaggcgtcggagaagatcatcatc
aacgtgggcggcacgcgacatgagacctaccgcagcaccctgcgcaccctaccgggcacc
cgccttgcctggctggcggatcccgacggcgggggtcggccagagtcggatggcggcggt
gcaggcagcagcggcagcagcggcggcggcgggggctgtgagttcttctttgatcggcac
ccgggtgtttttgcctatgtgctcaactactaccgcacgggcaagctgcattgccccgca
gacgtctgtgggcctctctttgaggaagagctcactttctggggtatcgatgagacagat
gtggaaccctgctgctggatgacctaccggcagcaccgcgatgctgaagaggcactggac
atcttcgagagcccggacgggggcgggggtggcgcagggcccggcgacgaggctggagac
gatgagcgggagttggccttgcagcgcctgggcccccatgaaggaggctctggccctggt
gctgggtccgggggttgccgtggctggcagccccgaatgtgggcgctcttcgaggacccg
tactcatcccgggcggccagggtggtagcctttgcctctctcttcttcatcttggtctcc
attaccaccttctgcctggagacccacgaggccttcaacattgaccgaaatgtgacggag
atccaccgggtagggaatatcaccagcgtgcgcttccggcgggaggtagaaacagaaccc
attcttacctacatcgagggcgtgtgcgtgatgtggttcactctagagttcctggttcgc
attgtgtgctgccctgatacgttggactttgtcaagaacctgctcaacatcatcgacttt
gtggccatcttgcccttttacctggaggtgggattgagtggcctgtcatccaaggcagct
cgagatgtgctgggtttcctgcgtgtggtgcgctttgtacgcatcctgcggatcttcaag
ctcacacgccactttgtggggctgcgtgtgctcggccacacactccgggccagcaccaac
gagttcctgctgcttatcatcttcctggccctgggtgtgctcatctttgccaccatgatc
tattatgctgagcgaatcggggccaggccatctgacccacggggcaatgaccacaccgac
ttcaagaacatccccatcggtttctggtgggctgtggtcaccatgacaacgcttggctat
ggggacatgtatcctaagacatggtcaggaatgctggtgggtgcgctgtgtgcactggct
ggtgtgctaaccattgccatgcctgtgcctgtcatcgtcaataactttggtatgtactac
tccctggctatggccaagcagaagcttcccaagaaacgaaagaagcatgtaccacggcca
ccccagcttgagtcacccatttactgcaagtctgaggagacttcaccccgggacagcacc
tacagtgacaccagcccccctgcccgggaagagggtatggtcgagaggaaacgagcagac
tccaagcagaatggtgacgctaatgcggtgctgtccgatgaggagggagctggcctcacc
cagcccctggcctcggcccccacccctgaagagcgtcgagccctgagacgctcaggcaca
cgggacagaaacaagaaggcagctgcctgcttcctgctcagtgctggggactatgcctgt
gctgatggcagtgtccagaaagaaggcagtgttgagccgaaagcgtgcgtcccagtgtct
cacacctgtgctctttaa

DBGET integrated database retrieval system