KEGG   Rattus norvegicus (rat): 684536Help
Entry
684536            CDS       T01003                                 

Gene name
Gba
Definition
(RefSeq) glucosylceramidase beta
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    684536 (Gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    684536 (Gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    684536 (Gba)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     684536 (Gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 684536
NCBI-ProteinID: NP_001121111
RGD: 1589149
Ensembl: ENSRNOG00000049281
UniProt: B2RYC9
Position
2q34
AA seq 515 aa AA seqDB search
MAARFIGLFLFQAISWAYGAQPCIPKSFGYSSVVCVCNATYCDSLDPLTLPALGTFSRYE
STRSGRRMELSTGSIQANRTGTGLLLTLQPEEKFQKVKGFGGAMTDATALNILALSPPAQ
KLLLKSYFSSEGIEYNIIRVPMASCDFSIRIYTYADTPNDFQLSNFSLPEEDTKLKIPLI
HRALKMSPRPISLFASPWTSPTWLKTNGAVNGKGSLKGHPGDIYHEAWANYFVKFLDAYA
THNIKFWAVTAENEPSAGLFTGYPFQCLGFTAEHQRDFISHDLGPALANSSHDVKLLILD
DQRLLLPRWAQVVLSDPEAAKYVHGIAVHWYMDFLAPAKATLGETHRLFPNMMLFASEAC
VGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVTGWTDWNLALNPEGGPNWVRNFVDSPI
IVDIPKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASEKTDLETVALIRPDGSAVVVVLN
RSSKDVPLTISDPALGFMETISPGYSIHTYLWRRQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggttcataggactcttcctatttcaggccatatcttgggcatatggtgcc
caaccctgcatccccaaaagttttggctacagctcagtggtctgtgtctgcaatgcaacg
tactgtgactctcttgaccccctgaccttaccggctctgggtaccttcagccgttatgag
agtactcgaagcggacgtcggatggagctgagtaccgggtccatccaggccaaccgcact
ggcacagggctcctactaaccttgcagccagaagagaagttccagaaagtgaaaggattt
ggaggtgccatgacagatgccactgcgctcaacatccttgccttgtcccccccggctcag
aaactgctactcaagtcctacttctctagcgaaggcattgagtataacatcatccgggta
cccatggccagttgtgacttctccatccgcatctacacctatgctgacacccctaatgac
ttccagttatccaacttcagcctcccggaggaagacaccaagctcaagatacccctgatt
caccgagccctgaagatgtccccacgccccatttcactctttgccagtccctggacatca
cccacttggctcaagaccaatggagcagtgaatgggaaagggtcactcaagggtcaccca
ggggatatctatcacgaggcctgggccaattactttgtcaagtttctggatgcttatgct
acacacaacatcaaattctgggcagtgacagcggagaatgaaccctctgcagggctcttc
actgggtaccccttccaatgcctgggcttcactgctgaacatcagagagactttatttcc
catgatctagggccagcccttgccaacagttctcatgatgtgaagctactcatactggat
gatcagcggctgctgctaccccgctgggcacaggtggtgctctctgacccagaggcagcc
aagtacgttcatggcatcgctgtccactggtatatggatttcctggctccagccaaagct
actttaggagagacacaccgcttgttccccaacatgatgctctttgcttcagaggcctgc
gtgggctccaagttctgggagcagagtgttcggttaggctcctgggatcgagggatgcag
tacagtcacagcatcattacgaacctcctttaccacgtaactggatggactgactggaac
cttgccctgaatcctgaaggagggcccaactgggtccgcaacttcgttgatagccccatc
attgtcgacatccccaaagacacattttacaagcagcccatgttctaccatcttggccac
ttcagcaagttcatccctgagggatctcagcgagtgggcttggtggccagtgagaagacc
gacttggaaacagtggcactgatacgccctgatggctctgcagttgtggtcgtgttaaac
cgatcgtctaaggatgtccctcttaccatcagtgatcctgccctgggcttcatggagacc
atctcacctggctactccattcacacttacctatggcgtcgccagtga

DBGET integrated database retrieval system