KEGG   Rattus norvegicus (rat): 684762
Entry
684762            CDS       T01003                                 

Gene name
H3c13
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    684762 (H3c13)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    684762 (H3c13)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    684762 (H3c13)
  09165 Substance dependence
   05034 Alcoholism
    684762 (H3c13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    684762 (H3c13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    684762 (H3c13)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    684762 (H3c13)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   684762 (H3c13)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 684762
NCBI-ProteinID: XP_038952070
RGD: 1586732
Ensembl: ENSRNOG00000061185
Position
17
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtactaagcagactgctcggaagtccaccggcggcaaggctccgcgcaagcag
ctggccactaaagccgcccgcaagagcgctccggccaccggaggcgtgaagaagccccac
cgctaccgtcccggcaccgtggctctgcgcgagatccggcgctatcagaagtccaccgag
ctgcttatccgcaagctgccattccagcgcctggtgcgcgagatcgctcaggacttcaag
accgaccttcgcttccagagctcggcggtcatggctctgcaggaagcgagcgaggcctac
cttgtgggtctgtttgaggacaccaacctatgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagctggcccgccgcattcgaggggagagggcgtaa

DBGET integrated database retrieval system