KEGG   Rattus norvegicus (rat): 684828Help
Entry
684828            CDS       T01003                                 

Definition
(RefSeq) similar to Histone H1.2 (H1 VAR.1) (H1c)
  KO
K11275  histone H1/5
Organism
rno  Rattus norvegicus (rat)
Brite
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    684828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Linker_histone
Motif
Other DBs
NCBI-GeneID: 684828
NCBI-ProteinID: XP_001072089
RGD: 1585568
Ensembl: ENSRNOG00000048264
UniProt: M0R7B4
Position
17p11
AA seq 220 aa AA seqDB search
MSETAPAAPAAPAPVEKTPVKKKAKKTSSAAGKRKASGPPVSELITKAVAASKERSGVSL
AALKKALAAAGYDVEKNNSRIKLGLKSLVSKGILVQTKGTGASGSFKLNKKASSGEAKPK
AKKVGAAKAKKPAGSAKKPKKATGSATPRKTKKTPKKAKKPGATAGAKKVSKSPKKVKAA
KPKKAAKSPAKAKAPKAKATKPKASKPKANKAKKAAPRKK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacagctcctgctgctcccgctgctcccgcacctgtggagaagacacctgtt
aagaagaaggccaagaagaccagctccgcagctgggaagcgcaaggcgtctgggcccccg
gtgtccgagctcatcaccaaggctgtggctgcttccaaggagcgcagcggcgtgtcccta
gctgcgcttaagaaggcgctggcagccgccggctacgacgtggagaagaacaacagccgc
atcaagctcggcctgaagagcctggtgagcaagggcattctggtgcagaccaagggcacc
ggcgcctccggctccttcaaactcaacaagaaggcgtcttctggcgaggccaagcccaaa
gcaaagaaagtaggggcggccaaggcaaagaagcctgcgggctcagccaagaagcccaaa
aaggctaccggttccgccacacccaggaagaccaagaagacccctaagaaagccaagaag
cccggggctactgccggcgccaagaaagtttccaagagcccgaagaaggtgaaggcagct
aagcccaagaaggcagccaagagtccagccaaggccaaggctcctaaggcaaaggctact
aagcctaaggcttctaagccgaaggccaacaaggcaaaaaaggccgctcctcgcaagaag
tag

DBGET integrated database retrieval system