KEGG   Rattus norvegicus (rat): 684871Help
Entry
684871            CDS       T01003                                 

Definition
(RefSeq) similar to Protein C8orf4 (Thyroid cancer protein 1) (TC-1)
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TC1 tRNA_bind_2 HalOD1
Motif
Other DBs
NCBI-GeneID: 684871
NCBI-ProteinID: NP_001108515
RGD: 1585525
Ensembl: ENSRNOG00000049811
UniProt: B0BND1
Position
16q12.5
AA seq 106 aa AA seqDB search
MKAKPSHPATSMSTSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKA
EERAKIIFAIDQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaaaccaagccacccagccaccagcatgtccacttctcttcgagtaagcccg
tccatccacggctaccacttcgacacagctgctcgcaagaaagctgtgggtaacatcttt
gaaaacatagaccaggagtccctgcagaggctcttcaggaactcgggagacaagaaggca
gaggagcgggccaagatcattttcgccatcgaccaagatttggaggagaaaactcgagcc
ctcatggccctgaagaagaggacaaaagacaagcttctccagttcctcaaactgcggaaa
tactccatcaaggtacactga

DBGET integrated database retrieval system