KEGG   Rattus norvegicus (rat): 684996
Entry
684996            CDS       T01003                                 

Gene name
Mplkip
Definition
(RefSeq) M-phase specific PLK1 interacting protein
  KO
K24575  M-phase-specific PLK1-interacting protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    684996 (Mplkip)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Kinase anchoring protein
     684996 (Mplkip)
SSDB
Motif
Pfam: MPLKIP
Other DBs
NCBI-GeneID: 684996
NCBI-ProteinID: NP_001102922
RGD: 1584365
Ensembl: ENSRNOG00000013806
UniProt: D3ZVR4
Position
17q11
AA seq 178 aa
MHRPNFRPPTPPYPSPGIGGWGGGNNFRGTLGGGPRPPSPRDGYGSPHHTPPCGPRARPY
GSSHSPRQGGSFSGARFGSPSPGGYPGSYSRSPAGSQHQFGYSPGQQQTYPQGSPRTSTP
FGSGRGREKRMSNELESYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcaccgaccgaattttcgaccaccaactcctccgtaccccagcccggggataggaggt
tggggtggcggaaacaacttccggggtaccctgggcggggggccgcggccgccctccccg
cgggacgggtacgggagtccgcaccacactccgccctgcgggccccgggctaggccgtac
gggagcagccactctccgcggcaaggcggcagcttctcgggggcccgcttcgggtctccg
tccccgggcggctacccaggctcctactccaggtcccccgcggggtcccagcatcagttc
ggctactccccagggcagcagcagacctacccccagggttctccaaggacatctacacca
tttggatcagggcgtggtagagaaaaaagaatgtctaatgagttggaaagttattttaag
ccttcaatgcttgaagacccttgggctggcctagaaccagtatctgtagtggatataagc
caacagtacagcaatacgcaaacattcacaggcaaaaaaggaagatacttttcttaa

DBGET integrated database retrieval system