KEGG   Rattus norvegicus (rat): 685055Help
Entry
685055            CDS       T01003                                 

Gene name
Atr
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno05165  Human papillomavirus infection
rno05166  HTLV-I infection
Module
rno_M00691  DNA damage-induced cell cycle checkpoints
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    685055 (Atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    685055 (Atr)
   04115 p53 signaling pathway
    685055 (Atr)
   04218 Cellular senescence
    685055 (Atr)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    685055 (Atr)
   05165 Human papillomavirus infection
    685055 (Atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    685055 (Atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    685055 (Atr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     685055 (Atr)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   685055 (Atr)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    685055 (Atr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I SgrT THP2
Motif
Other DBs
NCBI-GeneID: 685055
NCBI-ProteinID: XP_003750609
RGD: 1305796
Ensembl: ENSRNOG00000010027
UniProt: D3Z822
Position
8q31
AA seq 2636 aa AA seqDB search
MGDHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
TQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKDSCIEFSHWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKNPAIFGVLTRELLYLFEDLIYLHKRNAVGDVMEWPVVVSR
FLSRLDEHMGCLQPAPLQFMNMQNVEFIEVTLLMVLIHIVPTVFFRRQELLLWQIGCALL
EHGSPKIRSLAISLLTELFELGGLPAQPASTFFSLFLELLQHLIGMDADQLKLYEEPLSK
LVKTLFPFEAEAYRNIEPVYLNVLLEKLRVMFEDRVLMRLKSDLLKAALCHLLQYFLTFV
PAGYESALQVRKVYVTDICRALVDVLGVQTHVGYLLGPFYAALKMESTEIIERIQCQAQQ
ENLRGSNDGVSPKRRRLSSSLSSYKRPSRQSEEINHVDMDKKSILWNVLKQKAESLQISL
ECGTLKNSVAEALEGITIVLQLTALCTVHCSHQDMDGHNAKDCQHKYKKKPPVVITWMSL
DFYTKVLKSCKSLLESVQKHELELVIDSVVRIYDALMYIQVKSSFQDHVLEELCGMLSLP
WIYSYSDDNSLKMTTFATNLLRLSQRVWESYSPQAQSQCVFLLTLFPKRIFLDWRTTVYN
WALKSSHEVIRTSCVKGFFILLQQENSCNQIPKMLIDRVKDDSHVVKKEFASVLGQLVCT
LHGMFYLTSSSVEPFFGPVDLFCKNLKATSQHECSSSQVKASVCKPFLFLLTKNTPSPVK
LAFIDNLHHLCKHLDFQEDETEVKAVLGTLLNLMEDPDKDVRIAFSGNIKYILESLNSED
GFIKELFVLRMKEAYTHAQISRSNELKDTLILTTGDIGRAAKGDLIPFALLHLLHCLLSK
SASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSTPCQTAEM
RKQHVAHHREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGK
QLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNEL
LLRIGEHYQQVFNGLSILASFASSDDPYQGPRDITSPELMADYLQPKLLGILAFFNMQLL
SSSVGIEDKKMALTSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCF
VRCLDHAYLGPLLSHVIVALLPLIQMQPKETAAIFHYLIIENRVAVQDFLHEIYFLPDHP
ELEKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLI
KYATDSETVEPVISQLVTVILKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGK
DFTFVTGVEDLSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMQSNGPG
HQLWKRFPEHVREILEPHLNTRYKSSQKSTDWSGVTKPIYLSKLGNNFAEWSSSWAGYLI
TKVRDNLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCSQEDQQEVYAEIMAVLKHD
DQHAISTQDSASDLCQLSTQTVFSMLDHLTQWARHKFQALNAEKLAQNKPKGVSSVNFED
YQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQKHLGFLQKLYAAMHE
PDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLG
LGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTWSVRLG
QLLLSAKKRDTTAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEFIVRLHMLCELEHSLK
PLFHKFPGDSCNEDSLNWAARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMVGECWL
QSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFP
ENKSPTESKHMLIHGRATLLVGRFMEETANFESNAIMKKYKDVTLFLPEWEDGHFYLAKY
YDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAKAYEWE
KGGRSDRLQMRNDLAKINSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIA
KVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILTKAIHMKKSLEKFVGDATRLTDKLLEL
CNKSVDGSNSTLSMSTHFKMLKKLVEDPTFSEILIPLQSVMIPTLPSILGAHANHDPFPG
HWAYLAGFDDVVEILSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKS
LRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELRQ
CMLPKSAALSEKLKVFQEILLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVG
YILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGT
EGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPPNETGEVVNEKA
KTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
NT seq 7911 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaccacgggctggagctggcgtccatgattcccgccctgcgggagttgggcagt
gctactccagaggaatataatactgttgtgcagaaaccaagacaaattctctgccaattc
attgaccgaatacttacagatgtaaatgttgttgctctcgaacttgtaaagaaaactgac
actcagccgacctctgtgatgttacttgattttatccagcacatcatgaagtcttctcca
cttatgtttgtaaatgtgaatggaagccagggccaaaatgaggccaaagacagttgtatt
gaattcagtcattggatcattacaagacttttacggattgcagcaactccatcctgccac
atgctacacaagaaaatatgtgaagttatctgctcattattatttctttttaaaagcaag
aatcctgctatttttggggtactcacaagagaattactttatctttttgaagacttgatt
tacctccacaaaagaaatgcagtgggtgatgttatggaatggccagtggttgtcagtcga
tttttaagccgattggatgaacacatgggatgtttacagccagctcctttgcagttcatg
aacatgcaaaatgtagaatttattgaagtcactttattaatggttcttattcatattgtt
ccaactgtgttttttagacgacaagaattgttactgtggcagattggctgtgctctgcta
gagcatggtagtcccaagatcagatctttagcaattagccttttaactgagctctttgag
ctgggaggattaccagcacagccagccagcacctttttcagcctatttttggagttgcta
caacaccttataggaatggatgctgaccaactgaaattgtatgaagagccattgtcaaag
ctggtaaaaacactgttcccctttgaggcagaggcttatagaaatattgaacctgtttac
ttaaatgtgctgctggaaaaactccgagtcatgtttgaagatcgcgtgctcatgcggctc
aagtctgatttgctgaaagcagctctgtgccatttactgcagtatttcctcacatttgtg
ccagcggggtatgagtcggcgttacaggtcaggaaggtttatgtgactgatatttgtaga
gctcttgtagatgtcctcggagttcagacacatgtggggtatttgttgggaccattttat
gcagccttgaaaatggaaagtacggaaattattgagagaattcaatgtcaagctcaacag
gagaatctccgtggtagtaatgatggtgtgtcaccaaagaggcgtagactcagctcctct
ctcagctcttacaaaaggccatccagacagtctgaagaaattaatcatgtggatatggac
aaaaagagcatattatggaatgttctgaaacagaaagctgaatcccttcagatttccctt
gaatgtggtactctaaagaattctgttgctgaggcattagaaggaatcactattgtatta
cagctgactgctctctgcactgttcactgttctcatcaagacatggatggccataatgcc
aaggattgtcaacacaaatataagaagaaacctccagtagtaataacttggatgtctttg
gatttttatacaaaagtgcttaaaagctgtaagagtttgttagaatctgttcagaaacat
gaactggaattagtcatcgatagtgtggtgagaatttatgatgctttgatgtatatacaa
gtaaaaagttcatttcaagatcatgttctggaagagttatgtggaatgctctcacttcct
tggatttattcctattctgatgataactctttaaagatgaccacatttgctactaacctt
ctgcggttaagccagagggtttgggaaagttactctccacaggcacagtcacaatgcgtg
tttcttctgacactgtttccaaaaagaatattccttgactggagaacaacagtttataat
tgggccttgaagagctcccatgaagtaatccggactagttgtgttaaaggattttttatc
ttattgcagcaggagaattcttgtaatcaaattcccaagatgctaatagatagagtcaaa
gatgattctcacgtggtcaagaaagaatttgcttctgtccttggtcaacttgtctgtact
cttcatggcatgttttatttgacaagttcctcggtagagcctttctttggacctgtggac
ttgttctgtaagaacctgaaagccacttctcaacatgaatgttcatcttctcaagtaaaa
gcttccgtttgcaagccattccttttcctgctgactaaaaatacacctagtccagtaaaa
cttgctttcatagacaatctgcatcatctttgtaagcatcttgattttcaagaagatgaa
acagaggtaaaagcagttcttggcactttattaaatttgatggaagatccagacaaggat
gttagaatagcttttagtggaaatatcaagtatatattggaatctttgaactctgaagat
ggattcataaaagagctttttgtgttaagaatgaaggaagcatatacacatgcccagata
tcaaggagtaatgagctgaaggacaccttgattcttacaacaggggatattggaagggca
gcaaaaggagatttgataccttttgcactcttgcatttactgcattgcttgttgtctaag
tctgcatccgtctctggagcggcatacacagagatccgagcactagttgcagccaaaagt
gttaaactacagaattttttcagtcaatataagaaaccaatctgtcagtttttggtagaa
tctctccactccagtcagatgacagcactcccaagtactccttgccagactgctgagatg
cgaaaacaacatgttgctcatcacagagaaatggctttaaataccttatcagaaattgcc
aatgtttttgactttcctgatcttaatcgtttcctgacaaggacattacaagttctactt
cctgatctggccgccaaagcaagtcctgcagcatcggctctcatccgaactttagggaaa
caattaaatgtcaaccgtcgagagattttaataaataacttcaaatatattttttctcat
ttggtttgttcttgttccaaagatgaattagaacgtgcccttcattatctgaagaatgaa
acagaaattgagttggggagcctgttaagacaggattttcaaggattgcacaatgaatta
ttgctgcgtattggagaacattatcaacaagttttcaatggtttgtcaatccttgcctca
tttgcatctagtgatgatccgtatcaaggaccacgagatatcacatcgcctgaactgatg
gctgattatttgcaaccgaaattgttgggcattctagccttttttaatatgcagttactg
agctccagtgttggtattgaagataaaaaaatggccttgactagtttgatgtctttgatg
aagttgatgggacctaagcatgttagttctgtgagagtaaagatgatgaccacactgaga
actggactgagattcaaggatgatttccctgagttatgctgcagagcatgggactgcttt
gttcgttgtctggaccacgcttacctgggacccctgctcagtcatgtcatagtggctttg
ctacctctcatacagatgcagcctaaagaaactgcggctatctttcactacctcatcatt
gaaaacagggttgccgtgcaagattttcttcatgaaatatattttctgcctgatcatcca
gaattagaaaagataaaagcagttctgcaggaatatagaaaggaaacctctgagagtact
gatcttcaaaccactctccagctctctatgaaagcaattcagcatgaaaatgtagatgtt
cgtattcatgctcttaccagcttgaaggaaaccttgtacaaaaaccaggaaaaactgata
aaatatgcaactgatagtgaaacagtggagcctgttatctcccagcttgtgacagtaatt
ttgaaaggctgccaagatgcaaactctcaagctcgcttgctctgtggggaatgtttagga
gaactgggagcaatagacccaggacgattagatttctcaacaacagaaactcagggaaaa
gattttacatttgtgactggagtagaagatttaagctttgcctatggattgctgatggag
ctaacaagagcttaccttgcgtatgccgataacagccgagcacaagattcagctgcttat
gccattcaggagttactttctatttatgactgtagagagatgcagagcaatggcccaggc
caccagttgtggaagagattccctgagcacgtccgagaaatattagaacctcatcttaat
actagatataagagttcccagaagtcaacagattggtctggagtaacgaagccaatttac
ttaagtaaactaggtaataactttgcagaatggtcatcatcttgggcaggttatcttata
acaaaggtccgggataatcttgccagtaaaatcttcacctgctgtagtataatgatgaag
catgatttcaaagtcaccatctatctccttccacatatcctagtatatgtcttgttgggt
tgtagtcaagaagatcagcaagaggtttatgcagaaattatggcagtacttaagcatgat
gatcagcatgccatcagtacccaggacagtgcatcggatctgtgccagttgagtacacag
actgtgttctctatgcttgaccatctcacccaatgggcaaggcacaaatttcaggcattg
aatgctgagaaacttgcacaaaacaaaccaaaaggagtatcaagtgtgaattttgaagac
tatcagagtgtaactcgttttctagacctcatacctcaggatactctggctgtagcctcc
tttcgttccaaagcatacacacgagccgtaatgcactttgagtcatttattacagaaaag
aagcaaaatattcaaaagcatcttggatttctacagaaattgtatgctgctatgcatgaa
ccagatggagtggctggagtaagtgcaattcgaaaagcagagccatcactgaaggaacag
attcttgagcatgaaagtattggcttgctgagggatgccactgcctgttatgacagggct
attcagctagaaccggaccagatcattcattatcatggtgtcgtgaagtccatgttaggt
cttggtcagctgtccactgtaatcacccaggtcaatggagtgcatgctaataggtctgaa
tggacagatgaattaaacacatacagagttgaagcagcttggaaactgtcacagtgggat
ttggtggaaaactacttggcagcagatgggaaatccacaacgtggagtgtcagactagga
cagctactgttatcagctaaaaagagggacaccacagctttctatgacacactgaaacta
gtgagagcagaacaaattgtacctctctcagctgcaagcttcgaaagaggctcctaccaa
cgaggatatgaatttattgtcaggttacacatgttgtgtgagttggagcacagcctcaaa
ccactttttcacaagtttccaggtgacagttgtaatgaagactctctgaactgggcagct
cgactagaaatgacccagaattcctacagagcaaaggagcctatcctggccctccggagg
gctttattaagtctcaacaaaaggcctgattacaatgaaatggttggagaatgctggcta
cagagtgccagggtagctagaaaggctgggcaccatcagacagcctacaatgctctcctt
aatgctggagagtcacgacttgccgaactctatgtggaaagggcgaagtggctgtggtcc
aagggtgatgttcaccaggcgcttattgttcttcaaaagggggttgaattatgttttcct
gaaaataaatccccaactgagagtaagcacatgttaatccatggtcgagctacactgctc
gttggccggtttatggaagaaacagctaactttgaaagcaacgcaattatgaagaaatat
aaggatgtgaccttgtttctgccagagtgggaagatgggcatttctaccttgccaagtac
tatgacaagttgatgcccatggtaacagataacaaaatggaaaagcaaggcgatctcatc
cgatatatagtcctacattttggaagatctcttcagtatggaaatcagttcatatatcaa
tcaatgccacgaatgttatcgctatggcttgattttggtgctaaggcatacgaatgggaa
aaaggtggtcgttctgatcgtctgcaaatgagaaatgatttggcaaaaataaatagtgta
ctcacagagcacacaaatcggttagcaccatatcagtttttgactgctttttcgcagttg
atctctcgaatttgtcattctcatgatgaagtttttgttgtcttgatggaaataatagcc
aaggtctttctggcctatcctcagcaagcaatgtggatgatgactgctgtgtcaaagtct
tcttatcccatgcgtgtgaacagatgcaaggaaattcttaccaaagctatccatatgaaa
aagtctttagaaaagtttgtcggagatgcaactcgcctaacagacaagctactagagtta
tgcaacaaatcggttgatggaagtaattctacattgagcatgagcactcactttaaaatg
cttaaaaagctggtagaagacccaacatttagtgaaatcctcattcctttgcagtcagtc
atgatacctactcttccatcaattctgggtgcccatgctaatcatgacccctttcctggg
cattgggcctatcttgcaggcttcgacgatgtggtagaaattctttcttctcttcagaaa
ccaaagaaaatctccttaaagggctcagatggaaaattctatatcatgatgtgtaaacca
aaagatgatttgagaaaagactgtagactaatggaatttaattctttgattaacaagagc
ttaagaaaagatgcagaatcacgtcgaagagaacttcatatccgaacatatgcagttatt
ccactgaatgatgagtgtgggattattgaatgggtgaacaacactgctggcttgagacct
attctgaccaaactatacaaagaaaagggagtgtatatgacaggaaaggaacttcgccag
tgtatgctaccaaagtcagcagctttatctgaaaaactcaaagtattccaagaaatactc
ctgcccaggcaccctcctgtttttcatgagtggtttctaagaacattccctgatcctaca
tcatggtacagcagtaggtccgcatactgccgttctactgcggtcatgtcaatggttggc
tatatcctggggcttggagaccgtcatggtgaaaacattctttttgattctttcactggt
gaatgtgtacatgtagacttcaactgtctttttaataagggagaaacttttgaagttcca
gaaattgtaccatttcgactgactcataatatggttaatggaatgggtcctatgggaaca
gagggtctgtttcgaagagcatgtgaagttacactgagactgatgagggatcagcgcgaa
cctttaatgagtgtcttaaagacttttctgcatgatcctctcgtggaatggagtaaacca
gtgaaaggacactccaaagcaccaccgaatgaaaccggggaagttgtcaatgagaaggct
aagacccatgttcttgacattgaacaacgactacaaggtgtaatcaagacccggaataga
gtaacagggctgccgttatctattgaaggacatgtgcattatctcatacaagaagctact
gatgaaaacttactatgtcagatgtaccttggttggaccccatatatgtaa

DBGET integrated database retrieval system