KEGG   Rattus norvegicus (rat): 685072
Entry
685072            CDS       T01003                                 

Gene name
Rarg
Definition
(RefSeq) retinoic acid receptor, gamma
  KO
K08529  retinoic acid receptor gamma
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    685072 (Rarg)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    685072 (Rarg)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    685072 (Rarg)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   685072 (Rarg)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 685072
NCBI-ProteinID: NP_001128721
RGD: 1583230
Ensembl: ENSRNOG00000012499
UniProt: D3ZF61
Position
7q36
AA seq 458 aa
MATNKERLFAPNALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGPPDNY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSKPGPHPKASSEDEAPGSQGKRGQSPQPDQGP
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggccaccaataaggagcgactctttgcgcccaacgccctggggcctggatctggttac
ccaggagcaggcttcccgttcgccttcccaggtgcactcagagggtcaccgccatttgag
atgctgagccccagcttccggggccttggccagcctgacctccccaaggagatggcttct
ctctccgtggagactcagagcaccagctccgaggagatggtgcccagctctccctcaccc
ccaccacctcctcgggtctataagccgtgctttgtatgcaacgacaagtcttccggctac
cactatggggtcagctcctgcgaaggctgcaagggcttcttcagacgcagcatccagaaa
aacatggtgtatacgtgtcaccgtgacaaaaactgtatcatcaacaaggtaaccaggaat
cggtgccagtactgccggctgcaaaagtgtttcgaagtgggcatgtccaaggaagctgta
aggaatgaccggaacaagaagaaaaaggaggtaaaggaagaaggcccaccagacaactac
gaactgagtccacagttagaggagctcatcaccaaggtcagcaaagcccaccaggagact
ttcccctcactctgccagctgggcaagtacaccacgaactccagcgcagatcaccgggtg
caactggacctggggctgtgggacaagttcagtgagctggccaccaaatgcatcatcaag
attgtggagtttgcgaagcggctgcctggttttacaggactcagcattgctgaccagatc
acgctgctcaaggccgcctgcctggacatcctaatgctacggatctgtacaaggtatacc
ccagagcaagacaccatgacattctcggatgggctgaccctgaaccgaacccagatgcac
aatgctggctttgggccccttacagacctcgtcttcgcctttgcggggcagctcctgccc
ttggagatggatgacacggagactgggctgcttagtgctatctgcctcatctgtggagac
cgaatggacctggaagaacccgagaaggtggacaagctgcaggagcccctgttggaagcc
ctaaggctttatgcccggcgacggagacccagccaaccatacatgtttccaaggatgctc
atgaaaatcacagacctccggggcatcagcaccaagggagcagaaagagctataaccctc
aagatggagattccaggcccgatgccccccctgatccgagagatgctggagaaccctgag
atgtttgaggacgactcctcgaagcctggcccccaccccaaggcttccagtgaggatgaa
gctccagggagccagggaaaacggggccaaagtccccaacctgaccagggcccctga

DBGET integrated database retrieval system