KEGG   Rattus norvegicus (rat): 685079Help
Entry
685079            CDS       T01003                                 

Gene name
Sys1
Definition
(RefSeq) Sys1 golgi trafficking protein
  KO
K20318  protein SYS1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    685079 (Sys1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   Others
    685079 (Sys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SYS1 TraQ TPPK_C
Motif
Other DBs
NCBI-GeneID: 685079
NCBI-ProteinID: XP_001062200
RGD: 1583224
Ensembl: ENSRNOG00000014480
UniProt: D3ZY25
Position
3q42
AA seq 156 aa AA seqDB search
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSPSLDQMFDAEILGFST
PPGRLSMMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWW
LVQAVCIALMAVIGEYLCMRTELKEIPLSSAPKSNV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccagttccgcagctacgtgtgggaccctttgctgattctgtcgcagatcgtg
ctcatgcagacagtctactatggctctctgggcctgtggctggcgctagtggacgcgctg
gtgcgcagcagcccgtccctggaccagatgttcgacgccgagatcctgggcttctccacc
cctccaggccggctctcaatgatgtccttcgtcctcaacgccctcacctgtgccctgggc
ttgctgtacttcatccggcgcgggaagcagtgcctggatttcactgtcactgtgcatttc
tttcacctcctgggctgctggctctacagctcccgtttcccctcggcgctgacctggtgg
ctggtccaagctgtgtgcattgcactcatggccgtcatcggggagtacctgtgcatgcgg
acggagctcaaggagatccccctcagctcagcccctaagtccaatgtctag

DBGET integrated database retrieval system