KEGG   Rattus norvegicus (rat): 685222Help
Entry
685222            CDS       T01003                                 

Gene name
Cyp2b15
Definition
(RefSeq) cytochrome P450, family 2, subfamily b, polypeptide 15
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    685222 (Cyp2b15)
   00590 Arachidonic acid metabolism
    685222 (Cyp2b15)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    685222 (Cyp2b15)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    685222 (Cyp2b15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    685222 (Cyp2b15)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     685222 (Cyp2b15)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   685222 (Cyp2b15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 YhdB
Motif
Other DBs
NCBI-GeneID: 685222
NCBI-ProteinID: NP_001129140
RGD: 1596474
Ensembl: ENSRNOG00000020801
UniProt: Q64583
Position
1q52
AA seq 495 aa AA seqDB search
MELGVLLLLTFTVGFLLLLASQNRPKTHGHLPPGPRPLPFLGNLLQMNRRGLLRSFMQLQ
EKYGDVFTVHLGPRPVVILCGTDTIREALVDQAEAFSGRGTVAVLHPVVQGYGVIFANGE
RWKILRRFSLVTMRNFGMGKRSVEERIKEEAQCLVEELKKYKGALLNPTSIFQSIAANII
CSIVFGERFDYKDHQFLRLLDLIYQTFSLMGSLSSQVFELFSGFLKYFPGVHKQISKNLQ
EILNYIDHSVEKHRATLDPNTPRDFINTYLLRMEKEKSNHHTEFHHQNLVISVLSLFFTG
TETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRF
ADLIPIGLPHRVTNDTMFLGYLLPKNTEVYPILSSALHDPRYFDHPDTFNPEHFLDVNGT
LKKSEAFLPFSTGKRICLGEGIAQNELFIFFTAILQNFSLASPVAPEDIDLSPINSGISK
IPSPYQIHFLSRCVG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggaactcggtgtcttgctcctcctcactttcactgtgggcttcttgctattattagcc
agccaaaatcggccaaagacccatggccacttaccaccaggacctcgtcccctgcccttc
ttggggaacctcttacagatgaacagaagaggccttctgcgttctttcatgcagcttcaa
gaaaaatatggagatgtgttcacagtacacctgggaccaaggcccgtggtcatattgtgt
gggacagacaccataagagaggctctggtggaccaagctgaagcgttctctggtcgggga
acagttgctgtgctccatccagttgtacagggatatggtgtgatctttgccaatggggaa
cgttggaagatccttcggcgattctctctggtcaccatgagaaacttcgggatgggaaag
cgcagtgtagaggagaggataaaggaagaggcccagtgtttggtggaggaactgaagaaa
tacaagggagccctcctgaaccccacctccatcttccagtccatcgcagcaaacatcata
tgctccattgtctttggagagcgctttgactacaaagaccaccagttcctgcgtctgctg
gatctgatctatcagacattttcccttatgggctccttgtccagccaggtgtttgagctt
ttctctggcttcctgaaatacttccctggtgtccacaaacaaatctccaaaaacctacaa
gaaatcctcaactacattgaccacagtgtggagaagcacagggccaccttggaccccaac
actccacgagacttcatcaatacctaccttctgcgcatggaaaaggagaagtccaaccat
cacacagagttccatcaccagaaccttgtgatctctgtgctctctctcttctttactggc
accgagacgaccagcaccacactccgttacagcttcctgatcatgctcaagtacccccac
gtcgcagagaaagtccaaaaggagattgatcaggtgatcggctcacaccggctaccaacc
cttgatgatcgtaccaaaatgccatacactgatgcagtcatccatgagattcagagattt
gcagatctgatcccgattggtctaccacacagagtcaccaatgacaccatgttcctaggg
tacctgctccccaagaacactgaggtttaccccatcctgagttcagctctccatgaccca
cggtactttgaccacccagacaccttcaatcctgagcacttcctggatgtcaatgggaca
ctgaagaagagtgaagcttttctgcccttctccacaggaaagcgcatttgtcttggagaa
ggcattgcccaaaatgaattgttcattttcttcaccgccatcctccagaacttctctttg
gcaagccctgtggctcctgaggacattgacctcagtcccattaacagtggtataagcaaa
ataccctcaccataccagattcacttcctgtcccgctgtgtgggttga

DBGET integrated database retrieval system