KEGG   Rattus norvegicus (rat): 685232Help
Entry
685232            CDS       T01003                                 

Gene name
Atp6v1a, Atp6v1a1
Definition
(RefSeq) ATPase H+ transporting V1 subunit A
  KO
K02145  V-type H+-transporting ATPase subunit A [EC:7.1.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    685232 (Atp6v1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    685232 (Atp6v1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    685232 (Atp6v1a)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    685232 (Atp6v1a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    685232 (Atp6v1a)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    685232 (Atp6v1a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    685232 (Atp6v1a)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     685232 (Atp6v1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_Xtn ATP-synt_ab_N
Motif
Other DBs
NCBI-GeneID: 685232
NCBI-ProteinID: NP_001101788
RGD: 1596464
Ensembl: ENSRNOG00000001992
UniProt: D4A133
Position
11q21
AA seq 617 aa AA seqDB search
MDFSKLPKIRDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGD
MATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR
GVNVSALSRDIKWEFIPSKNLRVGSHITGGDIYGIVNENSLIKHKIMLPPRSRGSVTYIA
PPGNYDASDVVLELEFEGVKEKLSMVQVWPVRQVRPVTEKLPANHPLLTGQRVLDALFPC
VQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTMEVDG
KVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADSTSRWAEALRE
ISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDP
VTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAK
EILQEEEDLAEIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGM
LSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFKDPVKDGEAKIKAD
YAQLLEDMQNAFRSLED
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggatttctccaagctacccaaaatccgtgatgaagacaaagaaagcacatttggttat
gtgcatggagtctcagggcctgtggtcaccgcctgtgacatggcgggcgctgccatgtac
gagctggtgagagtggggcacagcgagctggtcggagagattatccgactggaaggtgac
atggccaccattcaggtgtacgaggaaacttctggtgtctctgttggagaccctgtactc
cgcactggtaaacctctctcggtagaacttggtcctggcattatgggagccatttttgat
ggtattcagagacctctatcggatatcagcagtcagacccaaagtatctacatccccaga
ggagtaaatgtgtctgctcttagcagagatatcaaatgggagtttatacccagcaaaaac
ctacgggttggtagtcatatcactggtggagatatttatgggattgtcaatgagaactcg
ctcatcaaacacaaaatcatgctacccccacgcagccgaggaagtgtgacttacatcgca
ccgcctgggaactacgatgcctctgatgtcgtcctggagcttgaatttgaaggtgtgaag
gagaagttgagcatggtccaagtgtggcctgtgcgtcaggtgcggcctgtcactgaaaag
ctgccagccaaccaccccttgcttactggccagagagtgctcgatgcccttttcccgtgt
gttcagggaggaactactgctattccaggtgcttttggctgtgggaagactgtgatttcc
cagtctctatccaagtactccaacagcgatgtgattatctatgtcggctgcggtgaaaga
gggaatgagatgtcagaagttctccgggacttccctgagctcactatggaagttgatggt
aaagtagagtccatcatgaagaggacagcgctggtagccaatacctccaatatgcctgtg
gctgcaagagaggcctccatttacactggaattacactatcagaatacttccgtgacatg
gggtaccacgtcagtatgatggctgactctacctctagatgggctgaggccctcagagaa
atctctggtcgcttagctgaaatgcctgcagatagtggataccctgcataccttggtgcc
cgactggcttctttctatgagcgagcaggcagagtgaaatgtcttggaaaccctgagaga
gaagggagtgtcagcattgtaggagcagtttctccacctggtggtgatttttctgatcca
gtcacatctgctactctgggtattgttcaggtgttctggggcttggataagaagctagct
cagcgcaagcacttcccgtccgtcaactggctcattagctacagcaagtacatgcgcgcc
ctggacgagtactatgacaaacacttcacagagttcgtgcctctgaggaccaaagctaag
gagattctgcaggaagaggaggatctggcggaaatcgtgcagctcgtgggaaaggcgtct
ttagcagagacagataaaatcaccctggaggtagcaaaacttatcaaagatgacttccta
caacaaaatgggtacactccttatgacaggttctgtccattctataagacggtggggatg
ctgtccaacatgatttcattctatgatatggcccgccgggctgtggagaccaccgcccag
agtgacaataagatcacatggtccattatccgtgagcacatgggggagattctctataaa
ctttcctccatgaaattcaaggatccagtgaaggatggcgaggcaaagatcaaggccgac
tacgcacagcttcttgaagatatgcagaacgcattccgtagcctggaagattag

DBGET integrated database retrieval system