KEGG   Rattus norvegicus (rat): 685244
Entry
685244            CDS       T01003                                 

Gene name
Iqsec2, RGD1562109
Definition
(RefSeq) IQ motif and Sec7 domain 2
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    685244 (Iqsec2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    685244 (Iqsec2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    685244 (Iqsec2)
SSDB
Motif
Pfam: IQ_SEC7_PH Sec7 PH_19 TNT
Other DBs
NCBI-GeneID: 685244
NCBI-ProteinID: NP_001264315
RGD: 1596452
Ensembl: ENSRNOG00000058975
Vega: OTTRNOG00000001744
UniProt: A0A0G2JZX5
Position
Xq13
AA seq 949 aa
MEPPWKSSRSTASHTLHQYCCPTQVLDSMKLTPSGRLAESSVEGDAPGSDLSTAVDSPGS
QPPYRLSQLPPTSSHMGGPPAGVGLPWSQRARLQPASVALRKQEEEEIKRSKALSDSYEL
STDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERLRSSASESRMSRRIIL
SNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGS
SVTTSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEEPGSAQLEKRESKEQQ
EDSSATSFSDLPLYLDDPVPPPSPERLPSTEPPPQGRPEFWAPAPLPPVPPPMPPGTRED
GSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPSDSSVDLSDRSDRGSVHRQLVYEADG
CSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGGRRLGKCE
AAGENSDGGDNESLESSSNSNETINCSSGSSSRDSLREPPATGLCKQTYQRETRHSWDSP
AFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGE
FLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYC
VCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIP
RDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLVCCCQLYEVPDPN
RPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIK
LLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYRVESELEKQKGMMRPN
ASQPGGAKDSVNGTLARSSLEDTYGAGDGLKRGALSSSLRDLSDAGVCY
NT seq 2850 nt   +upstreamnt  +downstreamnt
atggaacccccctggaagagcagcaggtccacagcgtctcatactctacaccagtattgc
tgtcctactcaggtccttgactccatgaagcttaccccctcaggcaggctggcagagagc
agtgtggagggtgatgccccaggcagtgacctgagcacagcggttgatagtcctgggagc
caacccccctaccggctgagccaactgcccccaaccagcagccacatggggggcccccct
gctggcgtgggcctaccttggtctcagagggctcgcctccagccagccagtgtcgccctg
aggaagcaggaggaggaggagataaagcgctccaaggccctgtcagacagctatgaactc
tccacagacctacaggacaagaaggtggaaatgctggagaggaagtatgggggctccttc
ctgagccgcagggctgccaggaccatccagacagcctttcgccagtatcgtatgaataag
aactttgagcgactgcgcagctcggcttcagagagccgcatgtcccgccgcatcatcttg
tccaacatgcggatgcagttctcctttgaggagtacgagaaagcacagaaccctgcatac
ttcgaaggcaagcctgcctcattggatgagggtgcaatggctggagcccggagccaccgg
cttgaacggggcctcccctatggaggctcctgtggtgggggcatcgatggtggtggaagt
tcagtcaccacatctggagagttttctaatgacatcacagagctcgaggactccttctcc
aaacaggtaaagtctctggctgaatccattgatgaggccttgaactgccacccatcaggg
cctatgtctgaggagccagggtcagcccaactggagaagcgggaatcaaaggaacagcaa
gaagacagctcagccacatccttcagtgacctccccctctacttggatgacccagttcct
cctccatcacctgagcgactgcccagcacagagcccccaccccaaggccgccctgagttc
tgggcaccagctcccctcccaccagttcctccaccaatgccaccagggacccgggaagat
ggtagccgtgaggaaggcactcgaaggggtcctgggtgcttggagtgccgggatttccgg
ctccgggctgcacacctccccctcctcaccattgagcctcccagtgacagttctgtagac
ctgagtgaccgctcagatcgcggctctgtccaccgccagctggtgtatgaggctgatggc
tgcagcccccatgggaccctgaagcacaaggggccaccaggcagggccccaatcccacac
cgccactaccctgcccctgagggtccagctccagccccaccagggcccctgccaccagcc
cccaatagtggtactgggcccagtggtgtggctggaggtcggaggttgggaaagtgtgag
gcagcaggtgagaactctgatggtggagacaatgagagccttgagagctccagcaactct
aatgagaccatcaactgcagctctggctcctcctctcgggatagcctgagggaacctcca
gccactggcctgtgcaagcagacttaccagcgggagacaaggcacagctgggactcgcca
gccttcaacaatgacgtggtacaaagaaggcattacagaattggcctcaacctcttcaat
aagaagccagagaagggtatccagtatttgatcgagcgaggcttcctgtcagacactcct
gtgggggtggctcacttcatcctggagcggaaaggcctgagtcggcagatgataggggaa
ttcctggggaatcgacagaagcagttcaacagagatgtgttggactgtgtggtggatgag
atggacttctcctctatggatttggacgatgcactcaggaagttccaatcccatatccga
gttcagggtgaggcccagaaagtggagcgactcattgaagctttcagccagcggtactgt
gtctgtaaccctgccctcgtacgacagttccggaacccagacactatcttcatccttgct
tttgccatcatcctcctcaataccgatatgtacagccccagtgtcaaggctgaacgcaag
atgaagctggatgacttcattaagaacctgagaggagttgacaatggtgaagacatcccc
cgagacctcctagtaggcatctaccagcgcatccaaggtcgtgaactaaggaccaacgat
gaccatgtgtcccaggtgcaggctgtggagcgcatgattgttggcaagaaaccggtcctg
tcgctccctcaccgtcgactggtttgctgctgccagctctatgaggtgccagatccaaat
cgcccccaaaggctggggctgcatcagcgggaggtcttcctcttcaatgacctccttgtg
gtcaccaaaattttccagaagaagaagatcttggtgacatacagcttccgtcagtccttt
cccctggtggaaatgcatatgcagctcttccagaattcatattatcagtttggaatcaag
ttactatctgcggtacctggaggggaacgaaaagttctcattatctttaatgctcctagc
ctccaagacaggctacgctttacctctgacctgcgggagtccattgctgaggtgcaggag
atggagaagtaccgtgtggaatcggagctggagaagcagaaaggtatgatgcggcctaat
gcctcacaacctggaggagccaaggactcagtgaatgggactctggcccgcagtagtctg
gaggacacttatggggcaggcgatgggctcaagcggggtgcactcagtagttccctgcga
gacctctctgatgcaggggtctgttattag

DBGET integrated database retrieval system