KEGG   Rattus norvegicus (rat): 685258
Entry
685258            CDS       T01003                                 

Gene name
Eny2
Definition
(RefSeq) ENY2, transcription and export complex 2 subunit
  KO
K11368  enhancer of yellow 2 transcription factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    685258 (Eny2)
   03019 Messenger RNA biogenesis [BR:rno03019]
    685258 (Eny2)
   03036 Chromosome and associated proteins [BR:rno03036]
    685258 (Eny2)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     685258 (Eny2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     685258 (Eny2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     685258 (Eny2)
SSDB
Motif
Pfam: EnY2 DUF2294 Sin3a_C
Other DBs
NCBI-GeneID: 685258
NCBI-ProteinID: NP_001124052
RGD: 1596439
Ensembl: ENSRNOG00000004681
UniProt: D3ZWF5
Position
7q31
AA seq 101 aa
MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLE
HVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
NT seq 306 nt   +upstreamnt  +downstreamnt
atggtggttagcaagatgaacaaagatgcgcagatgagagcagcgattaaccaaaagtta
atagaaactggagaaagagaacgcctcaaagagttgctgagagctaaattaattgagtgc
ggctggaaggatcagttgaaggcacactgtaaagaggtaattaaagaaaaaggactagaa
cacgttactgttgatgacttggtggctgaaatcactccaaaaggcagagccctggtacct
gacagtgtaaagaaggagctcctacagagaatcagaacattccttgctcagcatgccagt
ctttaa

DBGET integrated database retrieval system