KEGG   Rattus norvegicus (rat): 685394Help
Entry
685394            CDS       T01003                                 

Gene name
Arl14epl
Definition
(RefSeq) ADP ribosylation factor like GTPase 14 effector protein like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ARF7EP_C TSA
Motif
Other DBs
NCBI-GeneID: 685394
NCBI-ProteinID: XP_006222631
RGD: 1595054
Ensembl: ENSRNOG00000025590
UniProt: D3ZBL0
Position
18q11
AA seq 152 aa AA seqDB search
MTEPSHKNNSTQEERTNHVFPEKSSQIGQKQLQQIERQLKCLAFQNPGPQVADFNPETRQ
QKKKARMSKMNEYFSVKYKVMKKYDKNGRLICNDVDLCDCLEKNCLGCFYPCPKCNSNKC
GPECRCNRRWVYDAIVTESGEVISTLPFSVPD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaccatcacataagaacaactctactcaagaggagcgcacaaaccatgtgttt
ccagagaaaagcagtcagattggacagaagcaactgcaacagatagaacggcagctaaag
tgcttggcatttcaaaaccctggacctcaggtggcagattttaaccccgagacgaggcag
cagaaaaagaaagcacgaatgtcgaagatgaatgagtatttttctgtgaagtacaaggtg
atgaagaagtacgacaaaaatggcaggctgatctgtaacgatgtggacttgtgtgactgc
ctggagaagaactgcctgggatgcttctacccgtgtcccaagtgcaactccaacaagtgt
gggccggagtgccggtgcaaccggcgctgggtctatgatgctatcgtcaccgagtctggc
gaggtcatcagcaccctgccatttagtgttccagactag

DBGET integrated database retrieval system