KEGG   Rattus norvegicus (rat): 685465
Entry
685465            CDS       T01003                                 

Gene name
Polr3g
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC7
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    685465 (Polr3g)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    685465 (Polr3g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    685465 (Polr3g)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     685465 (Polr3g)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 BUD22
Other DBs
NCBI-GeneID: 685465
NCBI-ProteinID: NP_001102938
RGD: 1593792
Ensembl: ENSRNOG00000016260
Vega: OTTRNOG00000000949
UniProt: D4A1K1
Position
2
AA seq 223 aa
MAGNKGRGRAAYTFNIEAVGFSRGEKLPDVVLKPPPLFPDTDYKPVPLKTGEDEDYMLAL
KQELRETVKRLPYFIETPEEKQDDIERYSKRYMKVYKEEWEPDWRRLPREMMPRKKCKKA
DPKSKAAKATSKGTTLMNSTDVLKKIEELERRGEGERSDEENDEKEGSKEKEKDEEEDGE
EDAEQEEYDEEEQEEENDYINSYFDNGDDFVVDSDDNMDEATY
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctggcaataaaggaagaggccgtgctgcctatacctttaatatcgaagctgttgga
ttcagcagaggggagaagttacctgatgttgtgttgaagccacccccgctatttcctgat
acagattacaagccagtgcccctgaaaacaggagaagacgaggattacatgctggccttg
aaacaggagttgagggaaacagtgaaacgattgccttactttatcgaaacacctgaagaa
aaacaagatgatattgaaaggtatagcaagcgatacatgaaggtctataaagaagaatgg
gaaccagattggagaagacttccaagagagatgatgccaaggaaaaagtgcaaaaaagcg
gatccaaaatccaaagcagccaaagccacaagcaagggtactaccctcatgaattccaca
gatgtgttgaaaaagatcgaggaactggaaaggagaggcgagggtgaaaggtcggatgaa
gaaaacgacgagaaagaagggagcaaagagaaagagaaagatgaggaggaggatggcgaa
gaagatgcagaacaggaggagtatgatgaagaggaacaagaggaggagaatgactacatt
aactcctacttcgacaacggggatgattttgtggtagacagcgatgacaacatggacgaa
gccacctactag

KEGG   Rattus norvegicus (rat): 690254
Entry
690254            CDS       T01003                                 

Gene name
Polr3gl
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC7-like
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    690254 (Polr3gl)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    690254 (Polr3gl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    690254 (Polr3gl)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     690254 (Polr3gl)
SSDB
Motif
Pfam: RNA_pol_3_Rpc31 Pox_Ag35 Paf1 FYDLN_acid DUF913 NPR3
Other DBs
NCBI-GeneID: 690254
NCBI-ProteinID: NP_001103041
RGD: 1582857
Ensembl: ENSRNOG00000021209
UniProt: B4F7D3
Position
2
AA seq 218 aa
MASRGGGRGRGRGQLTFNMEAVGIGKGDALPPPTLQPSPLFPPLEFHPVPLPAGEEGEYV
LALKQELRGAMRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPSELKIR
VRKVQKERTTIILPKRPPKSTEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEGEE
EEYDEEEHEEETDYIMSYFDNGEDFGGDSDDNMDEAIY
NT seq 657 nt   +upstreamnt  +downstreamnt
atggccagccggggtgggggccggggtcgtggccgaggccagttgaccttcaacatggag
gctgtaggcattgggaagggtgacgctttgcctccacccactctgcagccctctccactc
ttccctcccttggagttccacccggtgcctctgcccgcaggagaggaaggggagtatgtc
ctggcgctgaagcaagagctgcgtggggccatgaggcagctcccctacttcatccggcca
gctgtccccaagagagatgtggaacgttactcagacaagtatcagatgtctgggccgatt
gacaacgccatcgattggaaccctgattggcgacgactacccagcgagctcaagattcga
gtgcggaaagtccagaaggagcggaccaccattatccttcccaagaggccccctaagagc
acagaggataaggaggagacgatccagaaactagagactctagagaagaaggaggaggaa
gtgacttcagaggaagatgaagagaaagaagaggaagaggagaaggaagagggggaggaa
gaggagtacgatgaagaggagcatgaggaggagactgattacatcatgtcatattttgac
aatggagaggactttggaggtgacagcgatgacaatatggatgaggccatatactga

DBGET integrated database retrieval system