KEGG   Rattus norvegicus (rat): 685472Help
Entry
685472            CDS       T01003                                 

Gene name
Lrrtm2
Definition
(RefSeq) leucine rich repeat transmembrane neuronal 2
  KO
K16665  leucine-rich repeat transmembrane neuronal protein 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    685472 (Lrrtm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Motif
Other DBs
NCBI-GeneID: 685472
NCBI-ProteinID: NP_001102939
RGD: 1593785
Ensembl: ENSRNOG00000047085
UniProt: D4A7P2
Position
18p11
AA seq 515 aa AA seqDB search
MGLHFKWPLGAPMLAAIYAMSVVLKMLPALGMACPPKCRCEKLLFYCDSQGFHSVPNATD
KGSLGLSLRHNHITALERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNK
IFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDC
RSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNK
ISNLTCGMEWTWSTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILSSL
RSLTTVGLSGNLWECSPRVCALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLC
WNLSTTVTAMATTYRDPTTEYTKISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFTQ
RVITGTMALLFSFFFIIFIVFISRKCCPPTLRRIRQCSMIQNHRQLRSQTRLHMSNMSDQ
GPYSEYEPTHEGPFIIINGYGQCKCQQLPYKECEV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgggcttacatttcaagtggccattaggggcccctatgctggcagcaatatatgcaatg
agtgtggtattaaaaatgctgcctgccctgggtatggcgtgtccacctaaatgccgctgt
gagaagctgctattctactgcgactctcagggcttccactcagtgccaaacgccacagac
aagggttctctgggcctgtccctgaggcacaatcacatcacagcgcttgaaagagatcaa
tttgccagcttcagtcaactcacctggctccacttagatcacaatcaaatttcaacagta
aaagaagatgctttccaaggactatataaactaaaggagttaatcttaagttccaacaaa
atattttacttgccaaacacaacttttacccaactgattaatctgcagaatttggacctc
tcttttaatcagctgtcatctctgcaccctgagctcttctatggccttcggaagctgcag
accttgcatctgcgttccaactccctgcggactatcccagttcgcctgttctgggactgt
cgtagtctagagtttctggatttgagcacaaaccgtttgcgaagtttggctcgcaatgga
tttgcaggattaatcaaactgagggagcttcatctagagcacaatcagctgacaaagatt
aattttgctcatttccttcggctaagcagtctgcacacactcttcttacaatggaacaaa
atcagcaacttgacgtgtgggatggagtggacctggagcactttagaaaagctagaccta
actggaaatgaaatcaaagccatcgacttgacagtgttcgagaccatgcctaatcttaaa
atacttctcatggataacaacaagttaaatagtcttgattccaaaatcttaagctccctg
agatccctcacaaccgttggcctctctggcaatctgtgggaatgcagccccagagtctgt
gctcttgcctcctggctgggcagtttccaaggtcggtgggagcattccatcctatgccac
agccctgaccacacccaaggagaggatattctagatgcagtccacggctttcagctctgc
tggaatttatcaaccactgtcactgccatggctacaacttatagagatccaaccactgaa
tatacaaaaataagctcatcaagttaccatgtaggagacaaagaaattccaactactgca
ggcatagcagttactacagaggaacactttcctgaaccagacaatgccatctttactcag
cgagtaattacaggaacaatggctttattgttttctttcttttttattatttttatagtg
ttcatttccaggaagtgctgccctcccactttaagaagaattaggcagtgctcaatgatt
cagaaccacaggcagctccgatcccaaacacgactccatatgtcaaacatgtcagaccaa
ggaccgtatagtgagtacgagcccacccatgaaggacctttcatcatcattaatggttat
ggacagtgcaagtgtcagcagctaccatacaaggaatgtgaagtataa

DBGET integrated database retrieval system