KEGG   Rattus norvegicus (rat): 685560Help
Entry
685560            CDS       T01003                                 

Gene name
Mogat3
Definition
(RefSeq) monoacylglycerol O-acyltransferase 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DAGAT Lipase_GDSL_2
Motif
Other DBs
NCBI-GeneID: 685560
NCBI-ProteinID: XP_001064308
RGD: 1592588
Ensembl: ENSRNOG00000029211
UniProt: F1LT39
Position
12q12
AA seq 326 aa AA seqDB search
MEVPSSPLHRSLQVFAVLQWVFSFLGLALLCLVTLILASLGRAWTLVVLYLLWLYQDRHT
PRMGGRRSAWVRNWAVWRYFRDYFPIKLVKTAELDPSQNYLFGFHPHGVLVVGAFSNFCT
EATGFSHLFPGLKPHLLMLPCWFQVPLFRDYIMTSGLVSSDKASTSYLLSHPEGGRVAVL
AVGGPLEALEAKPGTVSLRLRNQKGFVKLSLEHGASLVPVFSFGENDLFQQFPNPPGSWV
RRMQEALQRILSVALPLFHGRLGLLIPFRVPIHTVVGAPIPVQRSPRPTREQVNRLHELY
VERLTQLFEEHKMRYGVPADQHLVFI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcccctccagccccctgcatcggagtcttcaagtgtttgctgtgcttcagtgg
gtcttttccttcttgggacttgccctgctgtgcctggtgacattgattctagcctcccta
ggccgagcttggactcttgtggtcctctacctgctctggctctatcaagacagacacaca
cccaggatggggggtcgccggtctgcctgggtccgcaactgggcagtctggaggtatttc
cgagactactttcccatcaagctcgttaaaacggccgagttggatccgtctcaaaactac
cttttcggttttcatcctcacggggtcctggttgttggggcgttcagcaacttctgtaca
gaggccacaggcttctcccacctctttccgggtctcaagccacatttactcatgctgcca
tgttggttccaagtgcctctcttccgagattacattatgaccagtggtttagtctcttct
gacaaagccagcacttcctatctcttgtcccaccctgagggcggccgggtggccgttctg
gctgtgggaggtcccctggaggctttggaggcaaagcctggaacagtgagtttgcggctc
cggaatcagaaaggattcgttaaattatcactggaacacggggcctcgcttgtgcctgtc
ttctcctttggagagaatgacctcttccagcagtttcccaatccgccaggctcctgggta
cggaggatgcaggaggcacttcagaggatactgagtgtggccctgcctctcttccatggt
cgcctgggtctcctgattcccttccgtgtgcccatccatactgtcgtgggcgccccaatt
ccagtgcagcgaagcccgaggcccacccgggaacaggtgaaccggttgcacgagttatat
gtagagcgtctcacacagctgttcgaggaacacaagatgcgctatggggtccctgctgat
caacaccttgtattcatctag

DBGET integrated database retrieval system