KEGG   Rattus norvegicus (rat): 685607Help
Entry
685607            CDS       T01003                                 

Gene name
Pfdn2
Definition
(RefSeq) prefoldin subunit 2
  KO
K09549  prefoldin subunit 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    685607 (Pfdn2)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  GimC
   685607 (Pfdn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prefoldin_2 DegS OmpH Med9 Prefoldin TPD52 DUF4795 TMPIT APG6_N Spc24 Med21
Motif
Other DBs
NCBI-GeneID: 685607
NCBI-ProteinID: NP_001102946
RGD: 1591406
Ensembl: ENSRNOG00000003983
UniProt: B0BN18
Position
13q24
AA seq 154 aa AA seqDB search
MADSSGRVGKSGGSGTGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDT
LKEVDETRKCYRMVGGVLVERTVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFRE
KHNIRLMGEDEKPAAKENSEGAGAKSSSAGVLVS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcagcggtcgtgtgggcaagagcggcgggagtggcacggggaagggggcg
gtgtcggcggaacaggtaattgctggctttaatcgccttcggcaggaacagaggggcttg
gcctccaaagcagctgagctggagatggaactgaatgagcatagcctggtgatcgatacg
ctgaaggaagtggatgagacccgcaagtgctaccgcatggttggcggtgtgctggtagag
cggacggtcaaggaggtgctgcctgccttggagggtaacaaggagcagatacaaaagatc
attgagacactgtcacagcagcttcaggcaaagggaaaagaactcaatgaattccgggaa
aagcacaacattcgtcttatgggagaagatgagaagccagcagccaaggaaaactcagaa
ggagctggggctaagtccagctcagcaggggtgctggtctcttag

DBGET integrated database retrieval system