KEGG   Rattus norvegicus (rat): 685839Help
Entry
685839            CDS       T01003                                 

Gene name
Dnajb7
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B7
  KO
K09513  DnaJ homolog subfamily B member 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    685839 (Dnajb7)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   685839 (Dnajb7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-GeneID: 685839
NCBI-ProteinID: NP_001123982
RGD: 1589047
Ensembl: ENSRNOG00000019187
UniProt: D3ZN46
Position
7q34
AA seq 303 aa AA seqDB search
MVDYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNGE
KRDIYDKYGKEGLTGGGGSHLDDEREYGFTFRKADDVFKEIFGERDPFSFHFFEDSLADL
LSSSRSSSGSRSRGSLFSRSYDYPVFARLSSYDTGYSPYVSRGHESLTSVSSLAFEDPGV
GNYIPITPSVINGRNVKTKKTFENRQERKVEDDSELRSFLVNEEGFADKCNWRRQSFNDY
SPNSYTHSSTTQYSLVDDKEQGTPWVTNKKEPSIFSAGFKEGGRRKKKKHKEGQKKKSNK
RNR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtggactactatgaagttctaggagtacagagatacgcatcaccggaagacattaaa
agagcttaccgtaaagtagcacttaaatggcatcctgataaaaatccagaaaataaagag
gaagcagagcgaaaattcaaagaagtcgccgaggcatatgaagtgttatcaaatggtgaa
aaacgggacatttatgacaaatatggcaaggaaggcttaaccggtggaggtggaagtcat
cttgatgatgaacgtgagtacggtttcacattccgtaaggcagatgatgtctttaaagaa
atttttggtgaaagggatccattttcatttcacttctttgaagactcacttgcagacctt
ttaagcagttcaagaagctccagtggaagcagaagcagaggatcccttttctcccgatcc
tatgactacccagtgtttgccagactttcttcttatgacacgggatattcaccttatgtt
tctcgggggcatgagagccttacttcagtctcttccctggcatttgaggatcctggggtg
ggcaactatatacccattacaccgtcagttattaatggaagaaatgttaagacaaagaaa
acttttgagaaccgtcaagaaagaaaagttgaagatgacagtgagttgagatcctttctt
gtaaatgaagagggctttgcagacaaatgtaactggagaagacagtcattcaacgattat
tcaccaaattcctatacccattcaagtacaactcaatattctcttgtggacgacaaggaa
caaggaacaccttgggtcaccaacaagaaggaaccttccattttttcagcaggattcaaa
gaaggtggtaggaggaaaaagaagaagcacaaagaggggcagaagaagaagtccaataaa
aggaatcgctaa

DBGET integrated database retrieval system