KEGG   Rattus norvegicus (rat): 685840
Entry
685840            CDS       T01003                                 

Gene name
Ifnl3, Il28b
Definition
(RefSeq) interferon, lambda 3
  KO
K22669  interferon lambda 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    685840 (Ifnl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    685840 (Ifnl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    685840 (Ifnl3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   685840 (Ifnl3)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 685840
NCBI-ProteinID: XP_006223377
RGD: 1589046
Ensembl: ENSRNOG00000026584
UniProt: F1M3K4
Position
1q21
AA seq 192 aa
MLLLLLLLLATVLTRTQAHPVPRATRLPVEAKDCNIAQFKSLSPQELQAFRKAKDAIEEG
LLPKDVRRASRLLPRDGNLQQLQVQERQKALQAEVALTLKVLGNMTDPALVTILGQPLHT
LSHIHSQLQTCTEPQPTAEPTPQSRLLSRWLHRLQEAQNKETPGCLKAYVTLNLFRLLTR
DLKCVASGDQCA
NT seq 579 nt   +upstreamnt  +downstreamnt
atgctcctcctcctgctgctgctgctggccacagtgctgacaagaacccaagctcaccct
gtccccagggccaccaggctcccagtggaagcaaaggattgcaacattgctcagttcaag
tctctgtccccacaagagctgcaggccttcagaaaggccaaggatgccattgaagagggg
ctgctcccgaaggatgtgaggcgcgcttcccgcctcttgcccagggatgggaacctgcag
cagctgcaggtccaggagcgccaaaaggccttgcaggctgaggtggccctgacactgaag
gtcttggggaacatgactgacccagccctggtcaccatcctgggccagcctcttcacaca
ctgagccacatccactcccagctgcagacctgtacagagcctcagcccacagcagagccc
acgccccagagccgcctcctctcccgctggctgcacagactccaggaggcccagaacaag
gagacccctggctgcctgaaggcctatgtcaccctcaacctctttcgcctgctcacccgg
gacctcaagtgtgtggccagtggagaccagtgtgcctga

DBGET integrated database retrieval system