KEGG   Rattus norvegicus (rat): 685881
Entry
685881            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC685881
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF4605
Other DBs
NCBI-GeneID: 685881
NCBI-ProteinID: XP_006225762
RGD: 1589005
Ensembl: ENSRNOG00000051000
UniProt: M0R549
Position
6q13
AA seq 120 aa
MVRILANGEIVQDDDPRVRTTTQQRSSSTRQGFFNRGHSAPPGGPGPRQQQAGARLGAAQ
SPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMILGVRGLLLVGLVYLVSHLSQR
NT seq 363 nt   +upstreamnt  +downstreamnt
atggtgaggatcttggctaatggggagatcgttcaggatgatgacccccgagtgaggact
accacccaacagaggagtagcagcacccggcagggctttttcaacagaggccacagtgca
cctccagggggccctggaccccgccagcagcaggcaggtgcccgactgggtgctgcccaa
tctcctttcagtgacctgaaccggcagctggtgaacatgggcttcccacaatggcatctt
gggaaccacgtggtggagcctgtgacctccatcctcctgctcttcctgctcatgatactg
ggggttcgtggcctcctgcttgtgggtctggtctacctggtgtctcacctgagccagcgg
tga

DBGET integrated database retrieval system