KEGG   Rattus norvegicus (rat): 685958
Entry
685958            CDS       T01003                                 

Gene name
Ccl26
Definition
(RefSeq) C-C motif chemokine ligand 26
  KO
K21096  C-C motif chemokine 26
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    685958 (Ccl26)
   04061 Viral protein interaction with cytokine and cytokine receptor
    685958 (Ccl26)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    685958 (Ccl26)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    685958 (Ccl26)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   685958 (Ccl26)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 685958
NCBI-ProteinID: NP_001102958
RGD: 1587817
Ensembl: ENSRNOG00000001444
UniProt: D3ZQG2
Position
12q12
AA seq 94 aa
MKTFSLGPIVLLAVFLSVQLGVATCESEMPMPCCSYFSHYVIPWHWLYSYQITDSSCPNE
GVIFTTKTGKQYCVQPGDKWVQRYISLLNAKKHW
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagaccttctctttaggtcccattgttctcctggccgtcttcctcagtgtccagctt
ggtgttgccacgtgtgagagtgaaatgcccatgccctgctgttcctatttcagccactac
gtgatcccgtggcactggctgtacagctaccagatcaccgacagctcctgccccaatgag
ggcgtcatattcaccacaaaaactggtaagcaatactgtgtccagccaggggacaagtgg
gtgcagagatacatttccttgttgaacgccaagaagcattggtga

DBGET integrated database retrieval system