KEGG   Rattus norvegicus (rat): 686075Help
Entry
686075            CDS       T01003                                 

Gene name
Gapt
Definition
(RefSeq) Grb2-binding adaptor protein, transmembrane
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: GAPT SKG6 Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 686075
NCBI-ProteinID: NP_001102961
RGD: 1586621
Ensembl: ENSRNOG00000026989
UniProt: D4ACG3
Position
2q14
AA seq 156 aa AA seqDB search
MLKSFASSPVGVAVGVSLLVLLLACGIGCAWHWNRRETTPLTLPKFMQRRSSRHKDYTKN
VGVCAYVTGPSAKASVESKGQKSTAKGSKMHDNYENVEVSPPCTEGETEKGLYENTQPSN
FEEHVYGNQTDPLYYNFQKPSPPPQDEDIYILPDCD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaagctttgcgagttctccggtgggtgtggctgtcggcgtttccctcctagta
cttttgctggcctgtggaattggatgtgcttggcactggaatcgccgggaaaccacacca
cttaccttaccgaaatttatgcaaagaagaagcagcaggcataaagactacacgaaaaac
gtcggcgtgtgtgcctacgtgactggcccaagcgctaaagcctcagtggaaagcaaaggc
cagaaatctactgccaagggaagtaagatgcatgataactacgaaaatgtggaagtaagt
cctccctgcactgaaggggagactgagaagggcttgtatgaaaacacgcagccttctaat
tttgaggaacatgtctacgggaatcagaccgaccccctctattataacttccagaaacct
agtcctcctcctcaagatgaagacatatacatccttccagattgcgactag

DBGET integrated database retrieval system