KEGG   Rattus norvegicus (rat): 686081
Entry
686081            CDS       T01003                                 

Gene name
B3galt2
Definition
(RefSeq) Beta-1,3-galactosyltransferase 2
  KO
K07820  beta-1,3-galactosyltransferase 2 [EC:2.4.1.86]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Module
rno_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    686081 (B3galt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    686081 (B3galt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     686081 (B3galt2)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 1 chain
   686081 (B3galt2)
SSDB
Motif
Pfam: Galactosyl_T
Other DBs
NCBI-GeneID: 686081
NCBI-ProteinID: NP_001102962
RGD: 1586615
Ensembl: ENSRNOG00000003251
UniProt: D4A950
Position
13q21
AA seq 422 aa
MLQWRRRHCCFAKMSWNAKRSLFRTHLMGVLSLVFLFAMFLFFNHHDWLPGRPGFKENPV
TYTFRGFRSTKTETNQSSLRNIWKEVVPQTLRPQTATNSNNTELSPQGVTGLENTLSANG
SIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNETLA
PGIQITRIFLLGISIKLNGYLQHAIQEESIQYHDIIQQEYLDTYYNLTIKTLMGMNWVAT
YCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPP
DLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRVDPVPPPN
EFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACVNAAKEKAGRYRHRK
LH
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcttcagtggaggagaagacactgctgctttgcaaaaatgagctggaatgctaaaagg
tctctgttccggactcaccttatgggtgtactttctctagtgtttctttttgctatgttt
ttgtttttcaatcatcatgactggttaccaggtagaccaggattcaaagaaaatcctgtg
acatacactttccgaggatttcgttctacaaaaactgagacgaatcaaagctcccttcgg
aacatctggaaagaagtagttcctcagactttgcggcctcagacagcaactaactccaac
aacacagagctatcaccacaaggagttacaggactagagaacactctcagcgccaacgga
agcatttataatgaaaagggtactggacatccaaactcttaccatttcaaatatatcatc
aatgagcctgaaaaatgccaagagaaaagtccatttttaatcctactaatagctgcagag
cctggacaaatagaagcaagaagagctatacggcaaacttggggcaacgaaactttagca
cctggcatccaaatcacaaggattttcttgttgggcataagtattaagctaaatggctat
cttcaacatgcaatccaagaagaaagcatacagtatcatgatataattcagcaggaatac
ttagatacatactataatctgaccattaaaacactaatgggtatgaactgggttgcaaca
tactgtccacatactccatatgttatgaaaacggacagtgatatgtttgtcaacacagaa
tacttaatacacaagttactaaagccagacctgcctcctagacataactattttactggg
tatctaatgagaggctatgcacctaacagaaacaaagacagcaagtggtacatgccacca
gacctgtacccaagtgagcgttaccctgtcttctgctcaggaactggttatgttttttct
ggggatctggcagaaaagatatttaaggtttctttaggtatccgtcgtttgcacttggaa
gatgtatatgtagggatctgtcttgccaagttgagagttgatccagtgccccctcccaat
gagttcgtgttcaatcactggcgagtttcttattcaagctgtaaatacagccacctaatt
acctctcatcagttccagcctagtgaactgataaaatactggaatcatttacaacaaaat
aagcacaacgcctgtgtcaacgcagcaaaggaaaaggcaggcaggtatcggcaccgcaaa
ctacactag

DBGET integrated database retrieval system