KEGG   Rattus norvegicus (rat): 686087Help
Entry
686087            CDS       T01003                                 

Definition
(RefSeq) similar to motile sperm domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Motile_Sperm
Motif
Other DBs
NCBI-GeneID: 686087
NCBI-ProteinID: XP_006251462
RGD: 1586609
Ensembl: ENSRNOG00000058316
UniProt: Q5RJS6
Position
14q21
AA seq 213 aa AA seqDB search
MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKY
VVIDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVIATLLPS
AKEQQKEEEEKRIKEHLTESVFFEQSCQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGD
MESLVPLYLHLSVNQKLVAAYILGLITMAILRT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaacaaaaaagacaaccagagttagtggaagggaatcttcctgtctttgtgttt
cccacggagctaatattttatgcagatgatcagtcaacacataagcaagtgttgactctg
tacaatccctatgagtttgccttaaagttcaaagttttgtgtacgactccaaataagtat
gttgtcattgatgctgctggtgcagtgaagccacagtgctgtgtggatattgtcattcgt
catagagatgttcgatcgtgtcactatggtgtgatagacaaattccgtctccaggtttcg
gaacaaagccagaggaaagccttaggaaggaaagaggttattgctactcttctcccatct
gcgaaagaacaacaaaaggaagaagaggagaagagaataaaggagcacttaaccgagagt
gtattttttgagcagtcctgtcaaccagaaaacagagcagtctcttcaggacctagtttg
ctaactgtcttcctgggagtggtatgtattgcggccctgatgctgcctactctaggggat
atggaatcgctggtgcctctctacctccacttaagtgtgaatcaaaaattagtggctgct
tatatcttaggtcttatcacaatggctatacttagaacatga

DBGET integrated database retrieval system