KEGG   Rattus norvegicus (rat): 686310Help
Entry
686310            CDS       T01003                                 

Gene name
Ephb4
Definition
(RefSeq) EPH receptor B4
  KO
K05113  Eph receptor B4 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    686310 (Ephb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    686310 (Ephb4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     686310 (Ephb4)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   686310 (Ephb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N Haspin_kinase TMEM154
Motif
Other DBs
NCBI-GeneID: 686310
NCBI-ProteinID: XP_001069453
RGD: 1583193
Ensembl: ENSRNOG00000045952
UniProt: M0RDA4
Position
12q12
AA seq 987 aa AA seqDB search
MELRALLCWASLATALEETLLNTKLETADLKWVTYPQAEGQWEELSGLDEEQHSVRTYEV
CDMKRPGGQAHWLRTGWVPRRGAVHVYATIRFTMMECLSLPRASRSCKETFTVFYYESEA
DTATAHTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNIKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCSRLVTNLTYFPETVPRELVVPVAGSCVANAVPTASPSPSLYCR
EDGQWAEQQVTGCSCAPGYEAAEGNKVCRACGQGTFKPQIGEEPCLPCPANSHSNNIGSP
VCLCRIGYYRARSDPRSSPCTTPPSAPRSVVHHLNGSSLRLEWSAPLESGGREDLTYAVR
CRECRPGGSCLPCGGDLTFDPGPRDLVEPWVAIRGLRPDVTYTFEVAALNGVSTLATGPP
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLILSWAIPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKQGASYLVQVRARSEAGYGPFGQEHHSQTQLDESESWREQLAL
IAGTAVVGVVLVLVVIIIAVLCLRKQSSGREVEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSVPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFEVVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGAPGGTGGPTQQF
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagagcgctgctgtgctgggcttccctcgccactgctttagaagagaccctg
ctgaacacaaaactggagacggcagatctgaaatgggtgacttaccctcaggcagaaggc
cagtgggaggagctaagcggcctggatgaggaacagcacagcgtgcgcacctatgaggtg
tgcgatatgaagcgtccagggggccaggcacactggctgcgcactggctgggtcccacgg
cgaggtgctgtccacgtgtatgccacgatacgcttcaccatgatggaatgtctgtccctg
ccgagggccagtcgctcctgcaaggagacattcaccgtcttctattatgagagcgaagcc
gatactgccacggcccacacgccagcctggatggagaacccctacatcaaggtggacaca
gtggctgcggaacatctgactcggaagcgccctggagctgaagcaacagggaaagttaac
atcaagacgctgcgcctgggtcctctcagcaaagccggcttctacctggctttccaggac
caaggagcctgcatggccctgctctccttgcatctcttttacaagaagtgctcccggctg
gtcacgaacttgacctacttccccgagacggtgcctcgggagctcgtggtgccagtggca
ggtagctgcgtggccaatgccgtccctacggccagccccagccccagcctctactgccgg
gaagatggtcagtgggctgagcagcaggtcacgggctgcagctgcgcgccagggtacgag
gccgcggaagggaacaaagtgtgcagagcctgtggccaggggaccttcaagccccaaata
ggagaagagccctgcctgccatgcccagccaacagccactctaataacattgggtctcct
gtctgcctgtgtcggattgggtattaccgggcccgctcggatccccgcagttcgccttgt
accaccccaccctctgctccaagaagcgtagttcaccatctgaatggctcctccctgcgc
ctggagtggagtgccccccttgagtctggaggccgagaggacctcacttatgctgtacgc
tgccgagaatgccgtcctgggggttcctgcttgccctgtgggggcgacctgactttcgac
cctggtcctcgagacctggttgagccctgggtggcaatccgagggctgcgtcctgatgtc
acctatacctttgaggttgctgctttgaatggtgtgtctaccttagccaccggaccacct
ccttttgagcctgtcaatgtcaccactgaccgtgaagtgcctcccgcggtgtctgacatc
cgagtcactcggtcctcacccagcagcttgatcctgtcatgggctatccccagagcaccc
agtggggccgtgctggactacgaggtcaagtatcacgagaagggcgcagagggccctagc
agtgtacgtttcctgaagacatcagaaaaccgagctgagctccgggggctgaagcaggga
gccagctacctggtccaggtccgtgcacggtccgaggccggctatggtccctttggccaa
gagcatcacagtcagactcaactggatgagagcgagagttggcgggaacagctggccctg
atcgcaggcaccgcggttgtaggcgtggtcctggtcctggtggtcattattatcgcagtt
ctttgcctcaggaagcagagcagtgggagggaagtcgagtactccgataaacatgggcaa
tatctcatcgggcacggtaccaaggtctacattgatccctttacttacgaagaccctaat
gaggcagtgagggaatttgccaaagagattgatgtctcctatgtcaagattgaagaggta
attggtgcaggtgagttcggtgaggtgtgccggggtcggctgaaggcaccagggaaaaag
gagagctgtgtggccatcaagaccttgaagggtggctacacggagcgccagagacgtgag
ttcctgagcgaggcctccatcatgggtcagttcgagcatcccaacatcatccgcctcgag
ggtgtggtcactaacagcgtgcccgtcatgatcctcacagaattcatggagaatggagcc
ctagactctttcctgcggctgaacgacgggcagttcacagtcattcagctggtgggcatg
ctgagaggcattgcctcaggcatgcggtacctggccgaaatgagctatgtccatcgagac
ctggccgctcggaacatcctggtcaacagtaacctggtctgcaaggtgtccgactttggc
ctctccagattcctggaggagaactcctctgatcccacctacacaagttccctgggagga
aagattcccatccgatggaccgcccctgaggccattgccttcaggaaattcacgtctgcc
agtgatgcctggagctatgggatcgtcatgtgggaggtcatgtctttcggggaacggcca
tactgggacatgagcaaccaggacgtgatcaatgctattgaacaggactaccggctgccc
cctcccccagattgccccacctccctccaccagctcatgctggactgttggcagaaggac
cggaatgcccggccccgattcccccaggtggtcagcgctctggacaagatgatccggaat
cccgctagcctcaaaatcgtggccagggagaatggcggggcctcacatccactcctggac
caacggcagcctcactactctgcttttggttctgtgggcgagtggcttcgagccatcaag
atgggaagatacgaggaaagttttgcagcggctggattcggctcctttgaggtggtcagc
cagatctctgccgaggaccttctccgaattggagtcactctggcaggacaccagaagaaa
atcttagccagtgtgcagcatatgaagtcccaagctaagccaggagcccccggtgggaca
ggaggaccaacccagcagttctga

DBGET integrated database retrieval system