KEGG   Rattus norvegicus (rat): 686641Help
Entry
686641            CDS       T01003                                 

Definition
(RefSeq) similar to olfactory receptor 1160
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    686641
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    686641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 686641
NCBI-ProteinID: XP_001075089
RGD: 1595007
Position
3q24
AA seq 310 aa AA seqDB search
MSLKNATVKTEFLLLGFSDHPELQSLLFAVFFSIYSVTLMGNIGMILLITVSSNLHIPMY
FFLCILSFIDACYSSVIAPKLLVDLISDKKVISYNGCATQLYFFCSLVDTESFLLAAMAY
DRYIAICNPLLYTVLMSKRVCTQLAFGAFLGGTMSSIIHTTNTFQLSFCSKEINHFFCDI
SPLFSLSCSDTYTHDIILVVFASLVEALSLLAVLLSYMYIIVAILKTGSAEGRKKGFSTC
ASHLTVVTIYHGTLIFIYLRPSTGHSMDIDKMTSVFYTLIIPMLNPLIYSLRNKDVKFAF
RKMIRKNLFS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgaagaatgccactgtgaagactgaatttcttctcctgggattcagtgatcac
ccagaactccagagtcttctatttgctgtgtttttctccatctactctgttactctgatg
gggaatattggcatgatcttattgatcacagtcagttctaatttacacattcccatgtac
tttttcctctgtattctatccttcatagatgcatgctactcttctgtcattgcccccaaa
ttacttgtggatctgatttctgacaagaaggtgatttcttacaatggctgtgctacacag
ttatactttttctgctctctggttgacacagaatctttccttttggctgccatggcttat
gacagatacattgcaatctgtaaccccctgctctatactgtacttatgtccaagagagtc
tgtactcagctagcatttggtgcattcctaggtggaactatgagttcaataatccatact
actaatacattccagttgtcattctgctccaaagaaattaaccatttcttttgtgatatt
tctccactcttctctctgtcctgctctgatacctacacacatgatataatactggtagtg
tttgcaagtttggtggaagctctctcccttcttgctgttctcctctcctatatgtatatt
attgtggccattcttaaaacagggtctgcagagggaagaaagaaagggttttctacttgt
gcttctcacctaacagtagtcactatttatcatggtactctgattttcatttatttgcgt
cctagtacaggacattcaatggatattgacaagatgacctctgtgttttatacattgatt
atacccatgcttaaccccttgatatacagtctcagaaacaaagatgtcaaatttgccttc
agaaaaatgattaggaagaatttattttcttag

DBGET integrated database retrieval system