KEGG   Rattus norvegicus (rat): 687092Help
Entry
687092            CDS       T01003                                 

Definition
(RefSeq) similar to olfactory receptor Olr363
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    687092
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    687092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 687092
NCBI-ProteinID: XP_001077064
RGD: 1590077
Position
1q43
AA seq 310 aa AA seqDB search
MTLLDNRTEVTHFLLIGLTDDPGLQLPLFMIFLFIYTITLMGNLGMTLLIVLDSRLHTPM
YFFLCNLSLVDFCYSSAVTPTVMTGLLIEDKVISYSDCAAQMFFFAGFATVENYLLASMA
YDRYAAVCKPLHYSSTMTTSVCISLSIVSYACGFLNASIHIGDTFNLSFCGSNIVHHFFC
DVPAVMVLSCSDRHVSELVLVYVVSFNIFVAISVIWISYIFIFITIFKMKSSAGYRKAIS
TCASHFTAVSIFYGTIIFMYMQPSSSHSMDTDKIASVFYTMIIPMLNPLVYGLRNKEVKS
AFTKMLQVAK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacactgttggacaacaggacagaagtgacacacttcctcctgattggactcactgat
gatccaggcctacagcttcccctcttcatgatatttctcttcatttacactatcaccctg
atgggaaatctggggatgaccttgctgattgtcctggactctcgtctccacacacccatg
tacttttttctatgtaatctgtccttggttgatttttgctactcttcagcagtcacaccc
acagtcatgactgggctcttaattgaagacaaggtcatttcctacagtgattgtgctgct
cagatgttcttttttgcaggctttgctactgtggaaaattacctgctggcctcaatggct
tatgatcgctatgcagcagtttgtaagccactacattattcttctaccatgactaccagt
gtatgtataagtctttcaatagtttcctatgcctgtggtttcctgaatgcctccatccac
attggagacactttcaatctttctttctgtgggtccaatatagtccatcatttcttctgt
gatgttccagcagtcatggttctctcttgttctgatagacatgtcagtgagctggttctt
gtttatgtagtgagcttcaatatctttgttgctatctctgttatctggatatcctacata
ttcatttttatcacaatctttaaaatgaaatcaagtgctggatatcgaaaagctatatcc
acttgtgcctcacatttcactgcagtatccattttctatgggacaatcatattcatgtac
atgcagcccagctccagtcattccatggacacagacaaaattgcatctgtattctacacc
atgatcatccctatgctgaaccctctggtctatggcctgaggaacaaggaggttaagagt
gcattcacaaaaatgttgcaggtagcaaaatag

DBGET integrated database retrieval system