KEGG   Rattus norvegicus (rat): 687118
Entry
687118            CDS       T01003                                 

Gene name
Dedd2
Definition
(RefSeq) death effector domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DED
Other DBs
NCBI-GeneID: 687118
NCBI-ProteinID: XP_003748837
RGD: 1588968
Ensembl: ENSRNOG00000046112
UniProt: M0R7V1
Position
1q21
AA seq 331 aa
MALSGSTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAPGGLA
RARSGLELLLELERRGQCDESNLRLLSQLLRVLARHDLLPHLARKRRRPVSPERYSYGNS
SSSSKRTEDSGRCRRRASSSSHSPQSQWDTGSPPTKRQRRSQGRPSSGARQRRRAGLAAS
QQQQQQQQEPGRSSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQA
TAVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRL
LVSVDEADYEAGRRRLLLMEEEEGRRGTEAS
NT seq 996 nt   +upstreamnt  +downstreamnt
atggcgttgtccgggtcgaccccggccccgagctgggaggaggatgagtgtttggattac
tacggcatgctgtcgcttcaccgtatgttcgaggtagtgggcgggcagctgaccgagtgc
gaactggagctcctggccttcctgctggatgaggcccccggcgcccccggcggcctggcc
cgcgcccgcagcggcctggagctgcttctggagctggaacgccgcgggcagtgcgacgag
agcaacctgcggctgctgagccaacttctgcgcgtgctagcccgtcacgacctactgcca
catctggctcgcaagcggcgccggccagtgtcccctgagcgatacagctatggcaattcc
agctcgtcttccaagaggacagaggacagtggccggtgtcggcgacgggcgagcagttct
tcccattctcctcagagtcagtgggacacaggctccccaccaaccaagcggcagcgtcgg
agtcagggccgccctagcagtggtgccaggcagcggcggagagcgggcctggcagcctcg
cagcagcagcaacagcagcaacaggagccgggcaggtcgtcctcagaaggcaaggtgacc
tgtgacatccggctccgggttcgggcagagtactgcgagcatggaccagccttggagcag
ggcgtggcatcccggagacctcaggcattggcccggcagctggatgtgtttggacaggcc
actgctgtgctgcggtcaagagacctgggctctgtggtgtgtgacatcaaattttcagag
ctctcctatctggacgccttctggggtgactatctgagcggtgccctgctgcaggctctt
cggggcgtgttcctgactgaggccttgcgggaggctgtaggccgagaggctgtccgcttg
ctggtcagtgtggacgaggctgactatgaggctggccggcgccgcctgttgctgatggag
gaggaagaggggcggcgtgggacagaggcttcttga

DBGET integrated database retrieval system