KEGG   Rattus norvegicus (rat): 687295Help
Entry
687295            CDS       T01003                                 

Gene name
Timm50
Definition
(RefSeq) translocase of inner mitochondrial membrane 50
  KO
K17496  mitochondrial import inner membrane translocase subunit TIM50
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    687295 (Timm50)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    687295 (Timm50)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    687295 (Timm50)
Transporters [BR:rno02000]
 Other transporters
  Primary active transporters [TC:3]
   687295 (Timm50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NIF
Motif
Other DBs
NCBI-GeneID: 687295
NCBI-ProteinID: XP_001073346
RGD: 1587684
Ensembl: ENSRNOG00000037638
UniProt: D3ZJX5
Position
1q21
AA seq 353 aa AA seqDB search
MAASAALFSRLRSGLRVGARGLCTRLAPPPPRTPEQVTEIANRGGSKTQGPQHQPGSEGP
SYAKKVALWIAGLLGAGGTVSIVYIFGNNPVDENGTKIPDEFDSDPILVQQLRRTYKYFK
DYRQMIIEPTSPCLLPDPLREPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETL
FQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMEGHHVKDISCLNRD
PARVVVVDCKKEAFRLQPFNGVALRPWDGNSDDRVLLDLSAFLKTIALNQVEDVRTVLEH
YALEDDPLEAFKQRQSRLEQEEQQRLAELSKSNKQGLFFGSLTSRLWPRSKQP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcggcagctctcttctcgcgcttgcggagcgggctccgggtaggcgcgcgg
ggactgtgcacgcggctggcgccgccacctccccgcactccagaacaggttactgagatc
gccaaccgtgggggctccaagacccaagggccacagcatcagccaggctcagagggtccc
agctatgccaaaaaagttgcactgtggattgctggtttgcttggggctggtgggactgtc
agcatcgtctacatttttggaaacaaccccgtggatgaaaatggcaccaagattcctgat
gaattcgacagcgatccaattctggttcagcagttgcgccggacatacaaatacttcaag
gattacagacagatgatcatcgagcccaccagtccctgccttctcccagaccctctgcgg
gagccctactaccagccaccttatacactggtcctggagctcaccggggtccttctgcat
ccagagtggtcgctggccaccggctggaggtttaagaagcgcccaggcatcgagaccttg
ttccagcagcttgcccctctgtatgaaatagtcatcttcacatcagagactggcatgact
gcatttccactcattgatagtgtggacccccacggcttcatctcttaccgtctgttccgg
gatgccaccagatatatggagggacaccatgtgaaggacatctcgtgtctgaatcgggac
ccagcccgagtagtagtcgtggactgcaagaaggaagctttccgcctacagcccttcaat
ggtgtcgccttgcggccctgggatggcaactcagatgaccgggtcttgctggacctgtct
gccttcctcaagaccatcgcgctgaaccaagtagaggacgtccggactgtgctggagcac
tatgctctagaggatgacccattggaggcattcaaacagcggcagagccggcttgaacag
gaggagcagcagcgcctggcggagctctccaagtccaacaagcagggcctcttctttggc
tcactcaccagccgcctgtggcctcgatccaagcagccctga

DBGET integrated database retrieval system