KEGG   Rattus norvegicus (rat): 687424Help
Entry
687424            CDS       T01003                                 

Gene name
Dtx1
Definition
(RefSeq) deltex E3 ubiquitin ligase 1
  KO
K06058  deltex [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    687424 (Dtx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    687424 (Dtx1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     687424 (Dtx1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    687424 (Dtx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC WWE zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-ANAPC11 zf-UDP
Motif
Other DBs
NCBI-GeneID: 687424
NCBI-ProteinID: XP_001076559
RGD: 1585380
Ensembl: ENSRNOG00000050848
UniProt: M0RA58
Position
12q16
AA seq 627 aa AA seqDB search
MSRPGQGVMVPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTA
YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLT
VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPIAPAAPPAPPPPP
PPLPPGGPPSALVVRPSATFAGAALWAAPAAGPTEPAPPPGVPPRSPSAPNGAPTPGQNN
LSRPGPQRSTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRA
PKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTI
CMERLVTASGYEGVLRNKSVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKA
IYGEKTGTQPPGKMEFHLIPHSLPGFADTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFP
RHCYLPNNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGH
GYPDASYLDNVLAELTAQGVSEAMAKA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggccaggccaaggtgtgatggtgccggtgaacgggctgggcttcccgccgcag
aacgtagcccgggtggtggtgtgggagtggctcaacgagcacagccgctggcgaccctac
acggccaccgtgtgccaccacatcgagaatgttcttaaggaggatgcccggggctctgtg
gtccttggccaggtggacgcccagctggtgccctacatcatcgacctacaatccatgcat
cagttccggcaagacacaggtaccatgcggccagtgagacgcaacttctacgacccgtcg
tcggcgccgggcaagggcatcgtgtgggagtgggagaacgacggcggggcgtggacggcc
tacgacatggacatctgtatcaccatccagaacgcgtacgagaagcagcacccgtggctc
gacctctcatcgctcggcttctgctacctcatctacttcaacagcatgtcccagatgaac
cgccagacgcgccgccgccgccgcctgcgccgtcgcctggacctggcttacccgctcacg
gttggctccattcccaagtcgcagtcctggcccgtaggagccagctcgggtcagccctgc
tcctgtcagcagtgcctgctggtcaacagcacgcgcgccgcctccaatgccatcctggcc
tcacagcgccgcaaggcgcccattgcgccagccgcgcctccagcgcccccaccgcccccg
ccgccgctgccacccggagggcctccgagtgcgctcgttgtgcgccccagtgccaccttc
gccggggccgcgctctgggccgcacctgccgccggtcccacggagcccgcgccgcctcca
ggagttcccccaaggagccctagcgcccccaacggagcgcccaccccgggtcaaaacaac
ctcagccggccaggaccacagagatccaccagcgtcagcgcacgcgcttctattccacct
ggggttccggcgctccccgtgaagaacttgaatggcactggcccggtccacccagccctg
gcaggaatgaccgggatcctgctgtgtgcagccgggctgccagtgtgcctcacacgggcg
cccaaacccatcctgcacccgccgccagtaagcaagagcgatgtgaagcctgtgcctgga
gtgcccggtgtgtgccgcaagaccaagaaaaaacacctcaagaaaagcaagaatcccgag
gatgtggttcggaggtacatgcagaaggtgaaaaatccacctgatgaggactgtaccatc
tgcatggagcggctggtcacagcatccggctatgagggcgtgctccggaacaagagtgtg
cggcccgagctggtgggccgcctgggccgctgcggtcacatgtaccacctgctctgcctg
gtggccatgtactccaatggcaacaaggatggcagcctgcagtgccctacctgcaaagcc
atctatggggagaagacagggacacagccacctgggaagatggaatttcacctcatcccc
cactcgctccctggttttgcagacacccagactatccgcattgtgtatgacatccccacg
ggcatccagggccctgaacatcccaacccaggcaagaagttcaccgccagaggctttcct
cgccactgctacctacccaacaatgagaagggccggaaggtgctgagattgctcatcacc
gcctgggagcgcagactcatcttcactattggaacatccaacaccacgggcgagtcagac
accgtggtgtggaacgagattcaccacaagacggagtttggttccaacctcactggccac
ggctatccggacgccagttacctagacaacgtgctggctgagctcaccgcccagggtgtt
tctgaggctatggctaaggcctga

DBGET integrated database retrieval system