KEGG   Rattus norvegicus (rat): 687565Help
Entry
687565            CDS       T01003                                 

Gene name
Denr
Definition
(RefSeq) density regulated reinitiation and release factor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1
Motif
Other DBs
NCBI-GeneID: 687565
NCBI-ProteinID: NP_001108518
RGD: 1584200
Ensembl: ENSRNOG00000001106
UniProt: B0BNB2
Position
12q15
AA seq 194 aa AA seqDB search
MATDISESSGADTKNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNE
FAKLTVENSPKQETGISEGQGPVGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAK
KKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPE
VDDDSIEDLGEVKK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctactgacatttctgaatccagcggggctgatacgaagaacagtgccaagctagat
gcggattaccctctccgagtcctttattgtggagtctgctcgttaccaacagagtactgt
gaatatatgcctgatgttgctaaatgtagacaatggctagagaagaattttccaaatgaa
tttgcaaaacttactgtagaaaattcacccaaacaagaaactggaattagtgaaggccaa
ggaccagtaggggaagaggaggagaagaaaaaacaaaaaagaggtggaagaggtcaaata
aaacagaagaagaagacagtaccacagaaggtcacgatagccaaaatccccagagcaaag
aagaaatacgtgacgagagtgtgtggccttgcaacttttgaaattgatctcaaagaagca
caaagattttttgctcaaaaattctcctgcggtgcctcagtaacaggggaggatgagatc
atcattcagggagacttcacagatgacatcatcgatgtcattcaggaaaagtggccagag
gtagatgatgacagcattgaagaccttggagaggtgaagaagtga

DBGET integrated database retrieval system