KEGG   Rattus norvegicus (rat): 687750Help
Entry
687750            CDS       T01003                                 

Gene name
Fam102a
Definition
(RefSeq) family with sequence similarity 102, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: NT-C2
Motif
Other DBs
NCBI-GeneID: 687750
NCBI-ProteinID: XP_001080009
RGD: 1597535
Ensembl: ENSRNOG00000050834
UniProt: M0RAC2
Position
3p11
AA seq 392 aa AA seqDB search
MAFLMKKKKFKFQTTFTLEELTAVPFVNGVLFCKVRLLDGGDFVSLSSREEVQENCVRWR
KRFTFVCKMSANPATGLLDPCIFRVSVRKELKGGKAYSKLGFADLNLAEFAGSGSTVRCC
LLEGYDTKNTRQDNSILKVTIGMFLLSGDPCFKTPPSTAKSISIPGQDSSLQLTCKGGGT
SSGGSSSTNSLTGSRPPKARPTILGSGLAEEPEQSLSSPEEVFHSGHSRNSSYASQQSKL
SGHSTEHSRSSSLSDLTHRRNTSTSSSASGGLSMTVEGPEGSEREHRPSEKPPRPPEKPP
RPPRPLHLSDRSFRRKKDSVESHPTWVDDTRIDADDIVEKIMQSQDFTDGSNTEDSNLRL
FVSRDGSTTLSGIQLANRVSSGVYEPVVIESH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcttttttgatgaagaagaagaaattcaaattccaaaccacttttaccttggaggag
ctgactgcggtccccttcgtgaacggggtccttttttgcaaggtccggctgctggatggc
ggggattttgtcagcttgtcgtccagggaggaggtgcaggagaactgtgtgcggtggcgg
aagaggttcacgtttgtgtgtaaaatgagtgccaacccggccacaggcttgctggacccc
tgcatctttcgagtgtctgtgcgcaaggagctgaaaggtgggaaggcgtattccaagctg
ggcttcgctgacttgaacctggctgagtttgcaggctcaggctccaccgtgcgctgctgc
ctactggaagggtacgacaccaagaatacccgccaggacaactccatcctcaaggtcacc
attggcatgttcctgctctctggagacccctgtttcaagacgccaccatccactgccaag
tccatctccatcccgggccaggactcctccctgcagctgacatgtaaaggcggtggcacc
agcagcggtggcagcagcagcaccaattccctaactggatcccggccgcccaaggcccgg
cccactatcctgggctcaggtctagcagaggagccagagcagagcctgtccagtcctgag
gaggtgttccactccggccactcccgcaactccagctatgccagccagcagtccaagctt
tctggtcacagcacagagcactctcgctcctccagcctgtctgacttgacacaccgcaga
aatacatccacaagcagcagcgcctctggtggcctcagcatgactgtagagggtcctgag
ggcagtgagagggagcatcggccctctgagaagccacctcggcctcctgagaagccacca
cgccccccacgccccttgcatctgtcagaccgctcttttcggagaaagaaggactcagtg
gagagccacccaacctgggtggatgacactcgcattgacgcagatgacattgtggagaag
ataatgcagagccaggacttcacagacggcagcaacactgaggatagtaaccttcggctg
ttcgtgagccgtgatggctctaccacactgagcggcattcagctggccaacagagtctcc
tcaggagtctacgagccagtcgtgattgagagccactga

DBGET integrated database retrieval system