KEGG   Rattus norvegicus (rat): 687758
Entry
687758            CDS       T01003                                 

Gene name
Pip5kl1
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase-like protein 1 isoform X1
  KO
K13712  phosphatidylinositol-4-phosphate 5-kinase-like protein 1 [EC:2.7.1.68]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04144  Endocytosis
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    687758 (Pip5kl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    687758 (Pip5kl1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     687758 (Pip5kl1)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 687758
NCBI-ProteinID: XP_038962106
RGD: 1597527
Position
3
AA seq 606 aa
MAKKTQETGFKLPAATDNPRGVRPRFKRKLRGESSLQHPNQSPTIPPSQNQSSEDAASSG
VEPKGKGQRRFRGLSAKRTTVTRRPFLRHLSQETQSGQDQGSEDPASPEVGPAGKGKRPP
GELSPASATVAGRPFPRYLSRRQAALKDQDQSSEDAASLEVGPAGKGKRPSRRLGRKVTG
TPRLAVRNAEAEPDSCNPASEPNQEKLHLGAMAALSLGSREIPSHSLDVGNRSTSSGSRR
GLFWHLRAKHSRVGLFEIGPGHELHRMTRMMQEGLWAATQVSMNNPPTGPPTQKDFLEVM
TQVHKEGFELGTLAGPAFARLRQSIGLTEEDYQATLGPGDPYLQFLSTSKSKASFFLSHD
QRFFVKTQRRQEVQVLLAHLPRYVRHLQQYPHSLLARLLGVYSLRVAQGKKKYFIIMQCI
FYPTSRISERYDIKGCEVSRWVDPVPEGSPLLLVLKDLNFREKTIKLGTQRSWFLRQMAL
DTAFLRELNVLDYSLLVGVQFLHKDEKVDYHCLIGTIKSVQGAPKSENKDGQNRRMLPNL
PNALHIVDGPDQRYFLGLVDLTTVYGFRKRLEHLWKMVRYPGQSVSTVSPAHYARRLCQW
AEAHTE
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggctaaaaagacccaagaaacgggatttaagctacctgccgccacagacaaccctaga
ggcgtacgtcctcggttcaaaaggaaattgagaggagaatcatctctccagcaccccaac
caaagcccaacgatcccacctagccagaaccagagttcagaggatgctgcatcctcgggg
gtagaacccaagggcaagggccagcgtcgctttcgtggattgagtgcaaagcgtacaacg
gtgacaagaaggccttttctacggcacctcagccaggagactcagtccggtcaagaccag
ggttcagaggatcctgcatccccggaggtgggacccgcaggcaaaggcaagcgccctcct
ggcgaattgagtccagcgagtgcaacggtggcaggaaggcccttcccccgatacctcagc
cgacgccaggcagctttgaaggaccaggaccagagttcagaggatgctgcatccttggag
gtgggacccgcaggcaaaggcaagcgcccctctcgaagattgggcagaaaggtgacagga
acgccgcgattggccgttcgcaatgcggaggcggagcctgactcctgcaacccggcctcg
gagccaaatcaagagaagctgcacctgggggcgatggccgcactaagccttggttcccgc
gagatcccgtcccactccctggatgttggaaacaggtccacttcctcagggagccgccgt
ggcctcttttggcacctccgagccaagcattctagagttggcctgtttgagatcggtcca
ggacacgaactgcatagaatgacacggatgatgcaggaagggctgtgggctgccacccag
gtctccatgaacaacccacccacgggacctcctacccagaaggatttcctggaagtcatg
acccaggttcacaaagagggcttcgaactgggcaccctggctggtccagcttttgcacgg
ctgaggcaatccattggcctgactgaagaagactaccaggctactcttggccctggtgac
ccctaccttcaattcctcagcacctccaagagcaaggccagcttcttcctgtcccacgac
cagcgcttctttgtgaagacccaacgacgccaggaagtgcaggtgctgctcgcccacctg
ccccgctacgtgcggcacctgcagcagtacccacactccctgttggcacggttgctggga
gtatacagtttgcgggtggctcaggggaaaaagaagtacttcatcatcatgcagtgcatc
ttctaccctaccagccgcatctctgagaggtacgacatcaagggttgtgaagtaagccgc
tgggtggatccagtccctgagggcagcccccttctcttggtgctgaaggacctcaacttt
cgagaaaagaccataaaactgggaacccagcggagctggttcctccgccagatggcgcta
gacaccgccttcctgcgagagctgaatgtgctggattatagcctcctggtgggcgtccag
tttctccacaaagacgaaaaagtcgattaccactgcctcatcgggacaatcaagtctgta
caaggtgcaccaaagtcggagaacaaggacggccagaaccgacggatgctgcccaacctc
cccaatgccctccatatcgtggacggaccagaccaacgctattttctgggcttggtggac
ctaactaccgtgtatgggtttcgcaaacggctggaacatctgtggaagatggtgcgctat
ccaggccagagcgtctccactgtcagcccggctcactacgcccgtcgcctctgccagtgg
gcggaggcgcacactgagtga

DBGET integrated database retrieval system