KEGG   Rattus norvegicus (rat): 687813
Entry
687813            CDS       T01003                                 

Gene name
Traf1
Definition
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04210  Apoptosis
rno04668  TNF signaling pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    687813 (Traf1)
   04668 TNF signaling pathway
    687813 (Traf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    687813 (Traf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    687813 (Traf1)
   05202 Transcriptional misregulation in cancer
    687813 (Traf1)
   05203 Viral carcinogenesis
    687813 (Traf1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    687813 (Traf1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd
Other DBs
NCBI-GeneID: 687813
NCBI-ProteinID: NP_001258169
RGD: 1596290
Ensembl: ENSRNOG00000048914
Vega: OTTRNOG00000002313
UniProt: M0R5V5
Position
3p11
AA seq 409 aa
MASSSAPDENEFQFGCPPAPSQDPSEPRALCCTACLSENLRDDEERICPKCRADGLQPVS
PGSLLTQEKVLPDVAEAGIVCPFAGVGCSFKGSPQSVQEHEATSQSSHLYLLLGVLKEWK
SSPGPNLGSAPMALEQNLSELQLQEAVEVTGDLEVDCYRAPCCESQEELALQHLLKEKLL
AQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHVLNLEQRVVELQQTLAQKD
QVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCL
RLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLS
SASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDTSA
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcctccagctcagcccctgatgaaaacgagtttcaatttggttgtccccctgctccc
agccaggacccatcggagcccagagctctctgctgcacagcctgtctctctgagaacctg
agagacgatgaggaacggatctgtcctaaatgcagagcagacggcctccaacctgtgagc
ccaggaagccttctgactcaggagaaggttctccctgatgtggctgaggctggaatcgtg
tgtccctttgcaggtgttggctgttccttcaaggggagcccacagtccgtgcaggagcat
gaggccacctcgcagtcctcacacctgtacctgcttctgggggtcctaaaggagtggaaa
tcctcaccaggtcccaacctgggctctgcacccatggcactggagcagaacctgtcggag
ctgcagcttcaggaagctgtggaagtgacaggggacctggaggtagactgctaccgggca
ccttgctgtgagagccaggaagaactggctttgcagcacctcctgaaggagaagctgctg
gctcagctggaggagaagctgcgtgtgttcgcgaacatagttgctgtcctcaacaaggaa
gtggaggcttcccacctggcgctggccgcctccatccaccagagtcagttggaccgagag
cacgtcctgaacttggagcagagggtggtggagttacagcagaccctggctcaaaaagac
caggttctgggcaaacttgagcacagtctgcgactcatggaggaggcgtcctttgatggt
actttcctgtggaagatcaccaatgtcaccaagcggtgccacgaatcagtgtgtggcagg
actgtcagcctcttctctccagctttctacactgccaagtacggttacaagttgtgcctg
cgcctgtacctgaatggggatggctcaggcaagaagacccacctgtccctgttcattgtc
atcatgaggggagaatatgacgctctgctgccctggcctttccggaacaaggtcaccttt
atgctacttgaccagaacaaccgtgagcacgccattgatgccttccggcctgacctgagc
tcagcctccttccagcggccgcagagtgagaccaacgtggccagcggctgcccgctcttc
ttccccctcagcaagctgcagtcgcccaagcacgcctacgtaaaagatgatacaatgttc
ctcaaatgcattgtggacaccagtgcttag

DBGET integrated database retrieval system