KEGG   Rattus norvegicus (rat): 687827Help
Entry
687827            CDS       T01003                                 

Gene name
Gsg2
Definition
(RefSeq) germ cell associated 2 (haspin)
  KO
K16315  serine/threonine-protein kinase haspin [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    687827 (Gsg2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    687827 (Gsg2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     687827 (Gsg2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  Haspin family
   687827 (Gsg2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    687827 (Gsg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Haspin_kinase Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 687827
NCBI-ProteinID: XP_001080273
RGD: 1596276
Ensembl: ENSRNOG00000048660
UniProt: M0RBT0
Position
10q24
AA seq 751 aa AA seqDB search
MAASHRRSGTRLFRTYAARGVRRSQRQPDSLAVKWFQPPNPKLSFSSSLSDSNLSPAVAS
DNPEDPDFPGSPVGPRRRRPRGCDSPDLTHTKRVLRLRPRPPQKCSTPCSRLRPPPFLSC
SPGCLGSDLNVCIQSRNSNELGTSASLFSPPASPGAPDSLNADSTVPGSLHFRVASLGEA
SLPCPQEAATEEGKYTRSAPQAEASFRSSLSSRVDPRTTEAKELGTDGENVKESCCERQQ
TGNRLTDPDLASLGKRTATCKKVVSRGVDQIDYGESSARKDLRVPGKISRPKRTEPLRKR
KQQEAVGTSPLRYHQSKKKRKDSFCSRDLNTSCKDSWTKTRASFGFHKKKIITNVAEVCS
RSITSSLSRSFQSECSISILNRENSIVSSPCSSMYLLSPLKTLHITDKRPSYAEKVYGEC
NQEGPIPFSDCLSTEQLEHCEKIGEGVFGEVFQIINDQTPVALKIIAVEGSDLVNGSHQK
TFEEILPEIIISKELSLLSNEVYNCTEGFIGLNSVYCVQGLYPPLLLKAWDQYNTTKGSA
NDRPDFFQEDQLFIILEFEFGGIDLERMRTKLTSVATAKSILHQITASLAVAEASLHFEH
RDLHWGNVLLKKTNLKELHYTLNGKTSTIPTHGLQVNIIDYTLSRLERDGIVVFCDISAE
EDLFTGEGDYQFEIYRLMRKENKNCWGEYHPYNNVLWLHYLTDKILNKMRFKTKCHSAAM
KQIKRKLQHFHRTVLNFSSATDLLCRHSLFK
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtctcaccggaggtccggaacccggctctttcgaacgtacgcggcgaggggc
gtccggaggtcgcagcggcagcctgactcgctggctgtgaaatggttccagccgccgaac
ccgaagctctccttcagcagcagcctcagcgacagtaacctgtcaccggctgtcgcttcc
gacaaccctgaggaccccgacttcccgggcagcccggtgggcccgcggcgcaggcgtcct
cggggctgcgactctccggacctaacacacactaagagagtcctgaggctgcgacctcgg
ccccctcagaagtgcagcaccccgtgcagccggctgcgaccgccacctttcctcagctgc
agcccgggctgcctcggctcggacctcaacgtgtgcatccagtccaggaacagcaacgag
ctgggcaccagtgcctcccttttcagccctccggcctcgcccggagcccccgactctctg
aatgcagactctacagtccccgggagcctccacttccgggtagcctccctgggtgaagcg
tctctgccttgcccccaggaggcagcaaccgaagaaggcaagtacaccaggagtgccccc
caagccgaagccagcttcaggtcatctctctctagccgtgtggacccaaggaccacagaa
gctaaggagttggggactgatggggagaatgtgaaggaatcgtgttgtgaaagacagcag
acgggtaacagactaacggaccctgatctggcaagcctgggaaagagaaccgccacatgt
aaaaaggttgtgtcccgaggagtcgaccagatagactatggagagtccagtgctcgcaaa
gaccttcgtgtaccagggaaaatcagcaggcccaagagaactgaaccactccggaaaagg
aaacagcaagaagcagtgggaacatctcccctccgctatcaccaatctaagaagaaaagg
aaagattcattctgctccagggacttgaatactagttgtaaggattcttggaccaaaacc
agagcatccttcggttttcacaagaagaaaattataaccaacgtggcagaggtatgcagc
agatcgattaccagctctctctctaggtccttccagtctgaatgttcaatttctatcctg
aacagagaaaacagtattgtttcttctccatgctcttccatgtatttgctaagtccctta
aagaccctgcacatcacagacaaaaggccatcttatgctgaaaaggtttatggggagtgt
aatcaggaagggcctatcccctttagtgattgcctttctacagaacaactggaacactgt
gagaagattggggaaggagtgtttggggaagtgtttcaaataattaatgaccaaacacct
gtagccctaaagatcattgctgttgaaggatcagatttagtcaatgggtcccaccaaaaa
accttcgaggagatcctgccagagatcatcatctccaaagagctgagtctcctgtctaac
gaggtgtacaactgcacagaaggctttattgggctgaactcagtatactgtgttcaagga
ctttaccctcccttgctgcttaaagcctgggaccaatataacacaaccaaagggtctgca
aatgaccggcctgactttttccaggaagaccagctctttatcatcctggaatttgagttt
ggtgggattgacttggagcgaatgaggacaaagctaacctccgtggccaccgcaaagagc
atcctccaccagatcaccgcatccctggcagtagcagaggcctcactgcactttgagcac
cgggacttacactggggaaatgtgctcttaaagaaaaccaacctcaaagaactccactac
accctcaatgggaaaacaagcaccattcccacccatgggctacaagtcaacatcattgac
tatactctgtcccgcttggagcgggatgggattgtggttttctgtgacatctctgctgag
gaggacctatttacaggtgagggtgactaccagtttgagatctacaggctcatgaggaag
gagaacaaaaactgctggggcgagtatcacccttacaataacgtgctgtggctgcattac
ctcacggacaagattctgaacaagatgaggtttaagactaaatgccacagcgcagccatg
aagcagataaagaggaaactgcagcatttccacaggactgtactgaacttcagctccgcc
actgacctgctctgccgacatagtctatttaagtaa

DBGET integrated database retrieval system