KEGG   Rattus norvegicus (rat): 687896Help
Entry
687896            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC687896
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    687896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    687896
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    687896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx BCD 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 687896
NCBI-ProteinID: XP_003750902
RGD: 1596207
Ensembl: ENSRNOG00000047331
Position
10q24
AA seq 316 aa AA seqDB search
MEKGNQTVVSEFLLLGLPIEPRQQDLFYALFLAMYLTTTLGNLLIIVLIHLDSHLHTPMY
LFLSNLSFSDFCFSSVTIPKLLQNMRRQVPSIPYAGCLTQMYFFLLFADLESFLLVAMAY
DRYVAICFPLHYTSIMSPKLCLFLVALSWLLTTLISLSHTLLMARLSFCANHVIPHFFCD
MSALLKLACSDIQINNLVIFILGGLVIIVPFLLIFSSYTRIVSSILKVPSSRSIRKAFST
CGSHLSVVSLFYGTIIGLYLCPSANNSTVKETVMAVMYTVVTPMLNPFIYSFRNQDIKGA
FKRVFSKQMAKLSLRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggaaatcaaactgttgtttcagagttcctcctcctgggcttgcctattgaa
ccacgccagcaagacctgttctatgccctgttcctggccatgtacctcactaccaccctg
gggaacctcctcatcattgtcctcattcacctggactcccatctccacacacctatgtac
ctgtttcttagtaacttgtccttctctgacttctgcttttcctctgtgaccattcccaag
ttgctgcagaacatgcgaaggcaagttccatccatcccgtatgcaggttgcctcacacaa
atgtactttttcctgctttttgcagatctcgagagcttcctccttgtggccatggcctat
gatcgttatgtggccatctgcttccccctgcattatactagcatcatgagccccaagctc
tgtctcttcctggttgcactgtcttggttactgaccacactcatatctttgtcacatact
ctactcatggctcggctctcattctgtgctaatcatgtgatccctcactttttctgtgat
atgtcagctcttctgaagttagcctgctctgacattcagatcaataatttggtgatattt
atcttgggaggacttgtcattattgttccattcctgcttatattttcatcctatacacga
atagtgtcctccatcctcaaggtcccctcttctagaagcatccgcaaggccttctccact
tgtggttcccacctctctgtggtatctcttttctatggtacaatcattggtctatattta
tgtccatcagctaataactcaaccgttaaggagactgtcatggctgtgatgtacacagtg
gtgacccctatgctgaacccctttatctacagcttcaggaatcaggatataaagggagct
tttaaaagggtgttttcaaagcagatggctaaactttctctgagacagtga

DBGET integrated database retrieval system