KEGG   Rattus norvegicus (rat): 688288
Entry
688288            CDS       T01003                                 

Gene name
Eif4a3
Definition
(RefSeq) eukaryotic initiation factor 4A-III
  KO
K13025  ATP-dependent RNA helicase [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    688288 (Eif4a3)
  09122 Translation
   03013 RNA transport
    688288 (Eif4a3)
   03015 mRNA surveillance pathway
    688288 (Eif4a3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    688288 (Eif4a3)
   03041 Spliceosome [BR:rno03041]
    688288 (Eif4a3)
   03009 Ribosome biogenesis [BR:rno03009]
    688288 (Eif4a3)
   03012 Translation factors [BR:rno03012]
    688288 (Eif4a3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     688288 (Eif4a3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     688288 (Eif4a3)
   mRNA cycle factors
    Stress granule specific factors
     688288 (Eif4a3)
Spliceosome [BR:rno03041]
 Complex C
  Other components
   EJC/TREX
    688288 (Eif4a3)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   Helicases
    688288 (Eif4a3)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    688288 (Eif4a3)
SSDB
Motif
Pfam: DEAD Helicase_C AAA_19 AAA_30 ResIII AAA_22 Flavi_DEAD
Other DBs
NCBI-GeneID: 688288
NCBI-ProteinID: NP_001093628
RGD: 1591139
Ensembl: ENSRNOG00000045791
UniProt: Q3B8Q2
Position
10
AA seq 411 aa
MAATATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEK
PSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAV
QIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRA
IKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRIL
VKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNREL
YIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcggccacggccacgatggcgacgtcgggctccgcgcggaagcggctgctcaaagag
gaggacatgaccaaagtggagttcgagaccagcgaggaggtggacgtgacccccacgttc
gacaccatgggccttcgggaggacctgctgcgcggcatctacgcctacggttttgaaaaa
ccttctgcgatccaacagcgtgctatcaagcagataattaaagggagagatgtcattgca
cagtctcagtctggcacaggcaagacggccaccttcagtatttcagtccttcagtgcttg
gatatccaggttcgagaaacccaagctttgatattggctccaacaagagagttagcagtg
cagattcagaagggtctgcttgctttgggggattacatgaacgtgcagtgccatgcctgc
attggtggcaccaatgtcggggaggacatccggaagctggactatgggcagcatgttgtg
gcgggcacaccaggacgagtctttgatatgatccgccgtagaagtttaaggacacgggca
atcaagatgttggttttggatgaagctgatgaaatgttgaacaaaggtttcaaggagcag
atctatgacgtgtacaggtacttgccaccagccactcaggttgttctcatcagcgccacg
ctgccccatgagatcctggagatgaccaacaagttcatgaccgaccccatccgcatcttg
gtgaagcgtgatgagttgactctggaaggcatcaaacagttcttcgtggccgtggaaaga
gaggaatggaagttcgacactctctgtgatctctacgacacgctgaccatcacccaggct
gtcatcttctgcaacaccaagaggaaggttgactggctgacagagaaaatgagagaagcc
aatttcacagtgtcgtccatgcacggagacatgccccagaaagagcgtgagtccatcatg
aaggagttccggtcaggtgccagccgagtgctcatctccacagatgtctgggcgcggggc
ctcgatgtccctcaggtgtccctcatcattaactatgacctgcccaacaacagagaactg
tacattcacagaatcgggagatcaggtcgatatggacgcaaaggtgtggccatcaatttt
gtgaagaatgatgacatccgcatcctcagggacattgagcagtactactccacccagata
gatgagatgcctatgaatgtggctgacctcatctga

DBGET integrated database retrieval system