KEGG   Rattus norvegicus (rat): 688293
Entry
688293            CDS       T01003                                 

Gene name
Sgsh
Definition
(RefSeq) N-sulphoglucosamine sulphohydrolase isoform X1
  KO
K01565  N-sulfoglucosamine sulfohydrolase [EC:3.10.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    688293 (Sgsh)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    688293 (Sgsh)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.10  Acting on sulfur-nitrogen bonds
   3.10.1  Acting on sulfur-nitrogen bonds (only sub-subclass identified to date)
    3.10.1.1  N-sulfoglucosamine sulfohydrolase
     688293 (Sgsh)
SSDB
Motif
Pfam: Sulfatase DUF4976 Phosphodiest Sulfatase_C DUF1501
Other DBs
NCBI-GeneID: 688293
NCBI-ProteinID: XP_038943465
RGD: 1591134
Position
10
AA seq 502 aa
MHRPAVACCLLLLVLGLYGAHSRNVLLIVADDGGFESGVYNNTAINTPHLDALARHSLIF
RNAFTSVSSCSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVQSLPLLLSQAGVRTGI
IGKKHVGPETVYPFDFAFTEENSSVLQVGRNITRIKQLVRKFLQTQDDRPFFLYVALHDP
HRCGHSQPQYGAFCEKFGNGESGMGRIPDWTPQIYDPQDVMVPYFVPDTPAARADLAAQY
TTIGRMDQGIGLVLQELRGAGVLNDTLIIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPE
HPQRWGQVSDAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIQLTGRSLLPALEAEPPWAT
VFSSQSHHEVTMSYPMRSVYHQNFRLIHNLSFKMPFPIDQDFYVSPTFQDLLNRTAAGQP
TGWYKNLQHYYYRERWELYDISRDPRETRNLAAEPDFAQVLEVLKAQLVKWQWETHDPWV
CAPDGVLEEKLTPQCRPLHNEL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcaccgcccggcagtggcctgctgcttactgctgttggtcctgggactctacggcgcg
cactcgcgcaacgtgctgctgatagttgctgatgatggaggtttcgagagtggtgtgtac
aacaacaccgccatcaacacccctcacctggatgccctggcccgccacagccttatcttc
cgtaatgccttcacatctgtcagcagctgttccccgagccgtgccagtctcctcacgggc
ctgccccagcatcagaacggcatgtacgggctgcaccaggatgtacaccacttcaactct
ttcgacaaggtacagagcctaccgctgctgctcagccaggccggagtgcgcacaggcatc
atcgggaagaagcatgtgggcccggagacggtgtatccctttgacttcgcattcacagag
gagaacagctcagtgctgcaggtggggcggaacatcactagaattaagcaactcgtccgg
aaatttctgcagactcaggatgacaggcccttcttcctctatgtggccctccatgacccc
caccgctgtgggcactcccagccccagtacggagccttctgtgagaagttcggcaacggg
gagagtggcatggggcgcattccagactggacaccccagatctatgatcctcaggatgtg
atggtgccctactttgtcccagacacgccggcagcccgagctgacctagccgctcagtac
accaccattgggcggatggatcaagggataggattggtgctccaggagcttcgaggtgcc
ggtgtgctgaatgacaccctcatcatcttcacatccgacaacgggatccccttccccagt
ggcaggaccaacctgtactggcctggtacagctgagccactgttggtgtcctccccagag
cacccacaacgctggggccaagtcagcgacgcctacgtgagccttctagacctcaccccc
accatcctggactggttctccattccataccccagctatgccatcttcggctcaaagacg
attcagctcacaggccgttccctcctgccggcgctggaggcggagcccccttgggccact
gtcttcagcagccagagccaccacgaggtcaccatgtcctaccccatgcgctccgtgtac
caccagaacttccgcctcattcacaacctcagcttcaagatgccgtttcccatcgaccaa
gatttctacgtctcgccgaccttccaggacctcctgaaccgcaccgcggcaggccagccc
acgggctggtacaagaatctccaacattactactacagggaacgctgggaactctatgac
atcagccgggaccctcgggagacacggaacctggccgctgagccagacttcgctcaggtg
ctggaggtgctgaaagctcagctcgtcaagtggcagtgggagacgcatgacccctgggtg
tgtgcccctgatggggtcctggaggaaaagctcacgcctcagtgccgacctcttcacaat
gagctctga

DBGET integrated database retrieval system