KEGG   Rattus norvegicus (rat): 688400Help
Entry
688400            CDS       T01003                                 

Gene name
Edil3
Definition
(RefSeq) EGF like repeats and discoidin domains 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: F5_F8_type_C EGF hEGF EGF_2 cEGF
Motif
Other DBs
NCBI-GeneID: 688400
NCBI-ProteinID: XP_002729040
RGD: 1588887
Ensembl: ENSRNOG00000033064
UniProt: F1M6P8
Position
2q12
AA seq 479 aa AA seqDB search
MKHLVAAWLLVGLLGVPQFVKGDICNPNPCENGGICLSGLADDSFSCECPDGFTDPNCSS
VVEVASDEEKPTSAGPCIPNPCHNGGTCEISEAYRGDTFIDYVCKCPQGFNGIHCQHNIN
ECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHR
ALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPE
YIKSYKIAYSNDGKTWAMYKVKGTNEEMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQIC
RRHCTLRMELFGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQ
GKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTV
YQDAKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacttggtagcagcctggcttttggttggactcctcggtgtgccccagttcgtc
aaaggggacatttgcaaccccaatccctgtgaaaatggtggcatctgtctgtcaggattg
gcggatgattccttttcctgtgagtgtccagacggcttcacagatccaaactgctctagt
gttgtggaggttgcatcagatgaagaaaagcctacttcagcaggtccctgcatccccaat
ccatgccataatggaggaacttgtgagataagtgaagcatatcggggagacacattcata
gactatgtttgtaaatgtccccagggatttaatgggattcactgtcagcacaatataaat
gaatgtgaagctgagccttgcagaaatggtggaatatgtacggaccttgttgccaactac
tcctgtgaatgcccaggagaatttatgggacggaattgtcaatataaatgctctgggcca
ttgggaattgaaggtgggatcatatctaaccagcaaatcacagcttcatctacacatcga
gctctttttggactacagaaatggtatccctactatgctcggcttaataagaagggcctt
ataaatgcctggacagctgctgaaaatgacagatggccgtggattcagataaatttacaa
agaaaaatgagagtaacgggtgttattacccaaggagccaaaaggattggaagcccagaa
tacatcaaatcctacaaaattgcctacagcaatgacgggaagacctgggcaatgtacaaa
gtaaaaggcaccaatgaagaaatggtcttccgtggcaatgttgataacaacacaccctac
gctaattcctttacacctccaatcaaagctcagtacgtaagactctacccccaaatttgt
cgaaggcactgtacattaagaatggaactttttggctgtgagctctcaggctgttcagaa
cctttggggatgaaatccggacatatacaagactaccagatcaccgcctccagcatcttc
agaacactcaacatggacatgttcacttgggaaccgaggaaagccaggctggacaagcag
ggcaaagtgaacgcctggacttccggccataatgaccagtcacaatggttacaggttgat
cttcttgtccctaccaaagtgacaggcatcattacacaaggcgctaaggattttggtcat
gtgcaatttgttggttcatacaaactagcctacagcaatgatggggaacattggacggtg
taccaagatgcaaagcagagaaaagataaggtttttcaaggcaattttgataatgatact
cacaggaaaaatgtcatcgaccctcccatctatgcacgacacataagaatccttccttgg
tcctggtatggaaggatcactctgcggtcagagctgctgggctgcacagaggaggaatga

DBGET integrated database retrieval system