KEGG   Rattus norvegicus (rat): 688405Help
Entry
688405            CDS       T01003                                 

Gene name
Cdk2ap2
Definition
(RefSeq) cyclin-dependent kinase 2 associated protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: CDK2AP
Motif
Other DBs
NCBI-GeneID: 688405
NCBI-ProteinID: NP_001102968
RGD: 1588883
Ensembl: ENSRNOG00000018391
UniProt: D4A033
Position
1q43
AA seq 127 aa AA seqDB search
MSYKPIAPAPSSTPGSSTPGPGTPVPTAGSVPSPSGSVPGAAAPFRPLFNDFGPPSMGYV
QAMKPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAE
TERNART
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaaacctatcgcgcccgcccccagcagtacccccggctccagcacccccggg
ccaggcaccccggtccctacagccggaagtgtcccatcgccatcgggctcagtgccagga
gctgcagctcctttcagaccactgtttaacgactttggaccgccgtccatggggtatgta
caggcaatgaagccacccggttcccagggctctcagagcacctacacggacctgctgtct
gtcatagaggagatgggcaaagagatccgacccacctatgctggtagcaagagtgccatg
gagcgcctgaagagaggtatcatccatgctcgggcactagtcagagagtgcttggcagag
acagaacgcaatgcccgcacgtaa

DBGET integrated database retrieval system