KEGG   Rattus norvegicus (rat): 688452
Entry
688452            CDS       T01003                                 

Gene name
Spaca6
Definition
(RefSeq) hypothetical protein LOC688452
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Ig_3 ig I-set
Other DBs
NCBI-GeneID: 688452
NCBI-ProteinID: NP_001129192
RGD: 1588836
Ensembl: ENSRNOG00000039076
UniProt: B6ETS2
Position
1q12
AA seq 324 aa
MGLVALVGSFVLLLLLIFRASTWACLFCFTTHEERLSLCRMFVGSEDSKIRKCRDALTDA
FEGFSDMEINYDERSHLHDEFTQMTVFLQEVAAVQGEWSFWKAFTSAAAKLKRTIEHLKK
AQDCIPPCGVQEAARRFHCWGCFSTICDLPLDCPVQDMLVNRGDQALFSCIVAFQLPESE
VTYSWKYAGGGVRTQDVSYFRDLPGSHGYLARIRPVQPRHSGTFSCVILHDQRPLARLYF
YLNVTGPPPPEETELQVTFREVMRWTPREAEMIQPWRPSLGELLTRPQALTPGNLLLLAA
AAALGSASVTVLVWLLIRWYLSGN
NT seq 975 nt   +upstreamnt  +downstreamnt
atgggacttgttgccttagtagggagctttgtcctgttgctcctgctgatcttcagggca
tccacatgggcttgtctcttctgcttcactacgcatgaggaacgcctcagtctctgccgg
atgtttgtgggctcagaggactccaagatacgcaagtgtagagatgctctcacagatgct
tttgagggtttctcagacatggaaatcaactatgatgagaggagccacctgcatgatgaa
tttacacagatgacagttttccttcaggaggtggctgctgtccagggtgagtggtccttt
tggaaggccttcaccagtgctgcagcaaaattgaagaggaccattgaacaccttaaaaaa
gcccaggactgcatccctccttgtggggtccaagaggccgctaggcgtttccactgctgg
ggctgcttttccacaatctgtgatctgcctctagactgtccagttcaggacatgttggtg
aaccgaggggaccaggctttgttttcttgcatcgtggctttccagttgccagagtcggag
gtcacttattcctggaaatatgcgggaggaggtgtccggactcaggacgtttcctacttc
cgtgatttgccggggtctcacgggtacctggcacgaatccggccagtgcaacccaggcac
agtggaaccttttcctgcgtgatcctgcacgaccagcgccccctggcgcggctctacttc
tatctgaacgtgacggggcctcctccgcctgaggagactgagctccaggtcacgttccgg
gaagtgatgcgttggacaccgcgggaggcggaaatgatccagccctggaggcccagccta
ggcgaactacttaccagaccccaggctctgacgcctggcaacctactcctgctggcggct
gctgctgcacttgggtctgctagtgttactgtgctagtgtggctgttaattcgatggtac
ttaagtggcaactaa

DBGET integrated database retrieval system